KEGG   Burkholderia thailandensis H0587: BTL_3853Help
Entry
BTL_3853          CDS       T03113                                 

Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btz01100  Metabolic pathways
btz01110  Biosynthesis of secondary metabolites
btz01130  Biosynthesis of antibiotics
btz01230  Biosynthesis of amino acids
btz02024  Quorum sensing
Module
btz_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BTL_3853
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BTL_3853
Enzymes [BR:btz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     BTL_3853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AHI68223
LinkDB All DBs
Position
2:complement(579856..580974)
Genome map
AA seq 372 aa AA seqDB search
MQNLDNPQRDREAGCADATQDTTRIDDVRIGAVRPLISPALLQDELPVPGAVQTLVEASR
DAIGGVLHGRDDRLLAIVGPCSIHDHDQALDYARRLKAAADALRDDLLIVMRVYFEKPRT
TVGWKGYINDPRLDGSFRINEGLRAARRLLIDINALGLPAGTEFLDLLSPQYIADLIAWG
AIGARTTESQSHRQLASGLSCPIGFKNGTDGGVQVAADAIVAARASHAFMGMTKMGMAAI
FETRGNDTAHVILRGGKKGPNYDRASIDEACAVLRAADLREQVMVDCSHANSNKSHLRQI
DVAEDLARQLSDGERRITGVMVESNLEAGRQDLKPGVPLQYGVSITDACLSWAQTEPVLD
TLAQAVRRRRTA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacctcgacaacccgcagcgcgaccgggaagccggctgcgccgacgcgacgcag
gacacgacgcgcatcgacgacgtgcgcatcggcgcggtgcgcccgctcatctcgccggcg
ctgctgcaggacgaactgcccgtgccgggcgccgtccagacgctcgtcgaagcgagccgc
gacgcgatcggcggcgtgctgcacggccgcgacgatcgcctgctcgcgatcgtcggcccg
tgctcgatccacgatcacgaccaggcgctcgactacgcgcgccggctgaaggccgccgcc
gacgcgctgcgcgacgacctgctgatcgtgatgcgcgtgtatttcgagaagccgcgcacg
acggtcggctggaagggctacatcaacgatccgcgcctcgacggcagcttccgcatcaac
gaagggctgcgcgccgcgcgccggctgctcatcgacatcaacgcgctcggcctgcccgcc
ggcaccgaattcctcgatctgctgagcccgcagtacatcgcggacctgatcgcgtggggc
gcgatcggcgcgcgcacgacggaaagccagagccaccggcagctcgcatcggggctgagc
tgcccgatcggcttcaagaacggcaccgacggcggcgtgcaggtcgcggccgacgcgatc
gtcgcggcgcgcgcgagccacgcgttcatgggcatgacgaagatggggatggcggcgatc
ttcgagacgcgcggcaacgacaccgcgcacgtgatcctgcgcggcggcaagaagggcccg
aactacgatcgcgcgagcatcgacgaagcgtgcgcggtgctgcgcgcggcggacctgcgc
gaacaggtgatggtcgactgctcgcatgcgaattcgaacaagtcgcacctgcggcagatc
gacgtcgccgaggacctcgcgcggcagttgtcggacggcgagcggcgcattaccggcgtg
atggtcgagagcaacctggaggccggccggcaggatctgaagcccggcgtgccgctgcaa
tacggcgtgtcgatcaccgacgcatgcctgagctgggcgcagaccgagcccgtgctcgac
acgctcgcacaggcggtgcggcggcggcgcaccgcctga

DBGET integrated database retrieval system