KEGG   Burkholderia thailandensis H0587: BTL_3900Help
Entry
BTL_3900          CDS       T03113                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase family protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00550  Peptidoglycan biosynthesis
btz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTL_3900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:btz01002]
    BTL_3900
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btz01011]
    BTL_3900
Enzymes [BR:btz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BTL_3900
Peptidases and inhibitors [BR:btz01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BTL_3900
Peptidoglycan biosynthesis and degradation proteins [BR:btz01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BTL_3900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AHI66872
LinkDB All DBs
Position
2:complement(646062..647063)
Genome map
AA seq 333 aa AA seqDB search
MTTEPLSTALARRSRRTARALLRTPSRLFAALFVSAACAAPNGAQAAPAQAPGIQAVSWL
VVDADSGKTLGAHNVDARREPASLTKLMTAYVAFDALERAALRWDETVTVAADDIASVGR
DEARMYLTPGQRVRVRDLMRGLIVASANDAALVLAKRIGGSPAGFATLMNDTARRLGMRD
SHFVSPSGITTPDHYSTAHDLSILAQRLNRDFPAFYTFSSQRHFAYGAFSKTNKNRLLGA
DPSVDGMKTGHTNAAGWCMVVTAKRPIGGARAPHRVIAVLLGEPTEKQRLADARALLDQG
FASLGGGAPAANAALRANARPGEHRAQARARML
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgagcccctttcgaccgccctcgcacgccgcagccgccgcacggcgcgcgcg
ctgctccgcacgccctcgcgcctgttcgccgcgctcttcgtgtccgcggcatgcgccgcg
ccgaacggcgcgcaagccgcgccggcgcaggcaccgggaatccaggccgtgtcctggctc
gtcgtcgacgccgattccggcaagacgctcggcgcgcacaatgtcgacgcgcgccgcgag
ccggcgtcgctgaccaagctgatgaccgcgtacgtcgcgttcgacgcgctcgagcgcgcc
gcgctgcgctgggacgaaaccgtcaccgtcgccgccgacgacatcgcctccgtcggccgc
gacgaagcgcgcatgtatctgacgcccgggcagcgcgttcgcgtgcgcgacctgatgcgc
ggcctgatcgtcgcctccgcgaacgacgcggcgctcgtgctcgcgaagcgcatcggcggc
agccccgccggcttcgcgacgttgatgaacgacacggcgcgccggctcggcatgcgcgat
tcgcacttcgtgtcgccctccggcatcacgacgcccgatcactattcgaccgcgcacgac
ctgtcgattctcgcgcaacgtctgaaccgcgatttccccgcgttctacacgttctcgtcg
caacggcatttcgcgtacggcgcgttctcgaagaccaacaagaatcgtctgctcggcgcc
gatccgagcgtcgacggcatgaagaccggccatacgaacgcagccggatggtgcatggtc
gtcaccgcgaagcggcccatcggcggcgcgcgcgcgccgcatcgcgtgatcgcggtgctg
ctcggcgagccgaccgaaaagcagcggctcgccgacgcccgggcgctcctcgatcagggc
ttcgcgtcgctcggcggcggcgcgccagcggcgaacgccgcgcttcgggcgaacgcgcgc
cccggcgagcatcgcgcgcaagcgcgggcgcgcatgctctga

DBGET integrated database retrieval system