KEGG   Burkholderia thailandensis H0587: BTL_3925Help
Entry
BTL_3925          CDS       T03113                                 

Definition
(GenBank) penicillin binding transpeptidase domain protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00550  Peptidoglycan biosynthesis
btz01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTL_3925
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BTL_3925
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btz01011]
    BTL_3925
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:btz03036]
    BTL_3925
Enzymes [BR:btz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BTL_3925
Peptidoglycan biosynthesis and degradation proteins [BR:btz01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BTL_3925
Chromosome and associated proteins [BR:btz03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BTL_3925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AHI66365
LinkDB All DBs
Position
2:complement(678849..680639)
Genome map
AA seq 596 aa AA seqDB search
MRPNKKPKPSDPYVAVAKSPMLSSSLPMWRSKFIVILVFIAFGTLIARAFWVQIANQDFY
VGQGQKRYQRTIELGAMRGSIVDRNGALLAVSLTTYEIWANPKQVDEVAYAPLAKLLDMP
LAEVRRRLTGDRSFVLLKRQVDPETAARIEKLDIDGVTQIADSKRFYPEGESAAHVVGFT
NVDDRGQEGVELAANGRLSGTAGQRQVIRDRLGRIVSDTGPLVPAQHGATIELTIDRRIQ
QLAYAQLKSTIIANNAQAGSVVVLDAQNGEILALANYPTFDPNDRARLTGQQLRNRAVID
TFEPGSTIKPVVVALSIDAGKVRPQTIIDTSPGSYKIGPNVIHDTSNHGAITVAQALQMS
SNIALAKLALNLPAETIWNKYQEYGIGRAPELTFPGVASGRLRPYKRWRPIEQATMAYGY
GLSASLLQIAQVYTAYAGDGTIHPVSLLKSNDDPHSADARRGHRVTTPATAAAIRSMLEM
AVGQGGTGRAARVDGYRVGGKTGTARKQVGAAYVKGKYRALFAGMAPMSNPRLIIAVMID
EPAARSYYGGTVAGPVFSSVMSGSLQLLGVPPDAPIAADKPAGGAGGAKPQAKART
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgaacaaaaaaccgaagccgtccgatccttacgtcgccgtcgcgaaaagcccg
atgctgtcgtcgagcctgccgatgtggcgctcgaaattcatcgtgatcctcgtgttcatc
gcgttcggcacgctgatcgcccgcgcgttctgggtgcagatcgcgaaccaggatttctac
gtcggccaaggccagaagcgctatcagcgcacgatcgagctcggcgcgatgcgcggcagc
atcgtcgatcgcaacggcgcgcttctcgccgtgagcctcacgacctatgaaatctgggcg
aatccgaaacaggtcgacgaggtcgcgtacgcgccgctcgcgaagctgctcgacatgccg
ctcgccgaggtgcggcggcgtctcacgggcgaccgctcgttcgtgctgctcaagcgccag
gtcgaccccgaaactgccgcccgcatcgaaaagctcgatatcgacggcgtcacgcagatc
gccgattcgaagcgcttctacccggaaggcgaatcggccgcgcacgtcgtcggcttcacg
aacgtcgacgatcgcgggcaggaaggcgtcgagctcgccgcgaacgggcggctgtccggc
accgccggccagcgccaggtgatccgcgaccggctcggccggatcgtctccgacaccggc
ccgctcgtgcccgcgcagcacggcgcgacgatcgagctgacgatcgaccgccggattcag
cagctcgcgtacgcgcagctcaagtcgacgatcatcgcgaacaacgcgcaggcgggcagc
gtcgtcgtgctcgacgcgcagaacggcgaaatcctcgcgctcgcgaactatccgacgttc
gatccgaacgaccgcgcgcgcctgacgggccagcagttgcgcaaccgcgcggtgatcgac
acgttcgagccgggctccacgatcaagccggtcgtcgtcgcgctgtcgatcgacgcgggc
aaggtgcggccgcagaccatcatcgatacctcgccgggctcgtacaagatcggcccgaac
gtgattcacgacacatcgaaccacggcgcgatcacggtggcgcaggcgctgcagatgtcg
agcaacatcgcgctcgcgaagctcgcgctgaacctgcccgccgagacgatctggaacaaa
taccaggaatacggcatcggccgcgcgccggagctgacgttccccggcgtcgcgtccggg
cggctgcgcccgtacaagcgctggcggccgatcgagcaggcgacgatggcgtacggctac
gggctgtccgcgtcgctgctgcagatcgcgcaggtctacaccgcgtatgcgggcgacggc
acgatccatccggtgtcgctgctgaaatcgaacgacgatccgcattcggccgatgcgcgc
cgcggccatcgcgtgacgacgcccgccaccgcggcggcgatccgctcaatgctcgagatg
gcggtcggccagggcggcaccgggcgcgcggcgcgcgtcgacggctaccgcgtcggcggc
aagaccgggaccgcgcgcaagcaggtcggcgcggcctacgtgaagggcaagtatcgtgcg
ctgttcgccgggatggcgccgatgagcaatccgcgcctcatcatcgcggtgatgatcgac
gagccggccgcacggagctattacggcggcacggtcgcggggccggtgttctcgtcggtg
atgagcggctcgctgcaactgctcggcgtgccgccggatgcgcccatcgccgccgataag
ccggccggcggcgcgggcggcgcgaagccgcaggcgaaagcgaggacgtga

DBGET integrated database retrieval system