KEGG   Burkholderia thailandensis H0587: BTL_4348
Entry
BTL_4348          CDS       T03113                                 

Definition
(GenBank) PAS fold family protein
  KO
K02482  two-component system, NtrC family, sensor kinase [EC:2.7.13.3]
Organism
btz  Burkholderia thailandensis H0587
Brite
KEGG Orthology (KO) [BR:btz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:btz01001]
    BTL_4348
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:btz02022]
    BTL_4348
Enzymes [BR:btz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BTL_4348
Protein kinases [BR:btz01001]
 Histidine kinases
  NtrC family
   BTL_4348
Two-component system [BR:btz02022]
 NtrC family
  Unclassified
   BTL_4348
SSDB
Motif
Pfam: HATPase_c HisKA PAS_4 PAS PAS_9 HrpB7 Syntaxin
Other DBs
NCBI-ProteinID: AHI67324
LinkDB
Position
2:complement(1185699..1187123)
AA seq 474 aa
MSESTGMQMSEAIVEQLNCGVFSVGRDMRILAWNGFMQYHTGRSRDDAIGQDLFGLFPEL
PARWLRKKLESVFVLGVAMYTSWEHRPYLFRFDHSRPITGTIDAMRQNCSFVPLDDGRGG
VVAVGVTIVDATDVCIAHEALQNREKRLTEALAELTARHAELSDLNRELAHAHQQLLQSE
KLAAIGQLAAGIAHEINNPVGFVLSNVNTLGGYLAALIAHAHAVGRLVAERQPQLAPSLA
ELAREADLDYLCEDAPALVDESKEGLARVRKIVVDLRDFSRVDSVHQWEWVDIHHCIEST
LNIVRNEVKYAADLVREYAPLPMVRCIPSQVNQVVLNLVVNAAQSYASMRADGGHGGHGD
APRGTITIRTGVDADEAARIWFEVVDAGCGIAPENLKRIFDPFFTTKPVGKGTGLGLSVA
YGIVSAHGGEIAVSSAPGAGTTFRVTLPVEQAGAQRPDAAPGSHSTPAASGIAR
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgtccgaatccaccggtatgcagatgtccgaagcgatcgtcgagcagctcaactgcggc
gtgttctcggtcggtcgcgacatgcgcatcctcgcgtggaacggcttcatgcagtaccac
acgggccgctcgcgcgacgacgcgatcggccaggacctgttcgggctctttcccgagctg
ccggcgcgctggctgcgcaagaagctcgagagcgtgttcgtgctcggcgtcgcgatgtac
acgtcatgggagcatcggccctatttgttccgcttcgaccattcgcggccgatcaccggc
acgatcgacgcgatgcggcagaactgcagcttcgtgccgctcgacgacgggcgcggcggc
gtcgtcgcggtgggcgtgacgatcgtcgacgcgaccgacgtctgcatcgcgcacgaagcg
ctgcaaaaccgcgagaagcggctgaccgaagcgctcgccgagctgaccgcgcgccacgcg
gagctgtcggacctgaaccgcgagctcgcgcacgcgcatcagcaactgctgcagtcggag
aagctcgccgcgatcggccagctcgccgccggcatcgcgcacgagatcaacaatccggtc
gggttcgtgctgtcgaacgtgaacacgctcggcggttatctcgccgcgctgatcgcgcat
gcgcacgcggtcgggcggctcgtcgccgagcggcagccgcagctcgcgccgtcgctcgcc
gagctcgcgcgggaggcggatctcgactatctgtgcgaggacgcgccggcgctcgtcgac
gaatcgaaggaagggctcgcgcgcgtgcgcaagatcgtcgtcgatctgcgcgatttttcc
cgggtcgacagcgtgcatcagtgggaatgggtcgacatccatcactgcatcgaatcgacg
ctgaacatcgtgcgcaacgaggtgaaatacgcggccgatctcgtgcgcgagtacgcgccg
ctgccgatggttcgctgcattccgtcgcaggtcaatcaggtcgtgctgaacctcgtcgtg
aacgccgcgcagtcgtatgcgagcatgcgcgcggacggcggccacggcggccacggcgac
gcgccgcgcggcacgatcacgatccgcacgggcgtggacgcggacgaagccgcgcggatc
tggttcgaggtcgtcgatgcgggttgcgggatcgcgcccgagaacctcaagcggatcttc
gatccgttcttcacgacgaagccggtcggcaagggcacggggctcgggctgtcggtcgcc
tacggcatcgtcagcgcgcatggcggcgagatcgcggtgtcgagcgcgcccggcgcgggc
acgacgtttcgcgtgacgctgcctgtcgagcaggccggcgcgcagcggcccgacgcggca
ccgggttcccattcgacgccggccgcatccggcatcgctcgctga

DBGET integrated database retrieval system