KEGG   Burkholderia thailandensis H0587: BTL_4676Help
Entry
BTL_4676          CDS       T03113                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00440  Phosphonate and phosphinate metabolism
btz01100  Metabolic pathways
btz01120  Microbial metabolism in diverse environments
btz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BTL_4676 (aepX)
Enzymes [BR:btz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BTL_4676 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD L27
Motif
Other DBs
NCBI-ProteinID: AHI67225
LinkDB All DBs
Position
2:1645928..1647616
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLTSPSLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAHEWSGRAPLVIVPTKYYSTPTDAFRQAGISTV
IWANHLIRASASAMQAVAREIQESETLVNVEERVATVNEIFRLQDADEYSAAERIYLSSS
SRASNAALVLAASRGNGLEAVTEDKPKVMLPIAGKPLLRWLVDGFKKQGVNDITVVGGYR
ADAIDTSGVKLVVNERHAQTGELASLACAAERLTGDTIVSYGDLLFRSYILRDLAESEAE
FSVVVDSSQTQPSNQSVRDFAFCSAADDRGLFGQKVHLRRVSSDASEAAPHGRWIGLLNV
RGAGVARLKAMLDTLKARDDFDSLDLPALLNALVDAGERIEVQYVHGHWRGVNDLDDFRR
AGDFAHGQTPYAEQNAGNGGAR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaaccgaatttcaccgaatcgcgcagcgcgcggctgcggcggatgctg
acgagcccgtcgctcgaattcctgatggaggcgcacaacggcctgtccgcgcgcatcgtc
cgcgaggcgggcttcaagggcatctgggcgtcggggctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaggcgagctggacgcaggtggtggacgtgctcgagttcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccggctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagtttccgaagaccaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggatttctcg
atcgtcgcgcgcgtcgaggcgctgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcttacgcggaagcgggtgccgacgcgatcctgattcacagcaagctgtcgcgg
cccgacgagatcctgcagttcgcgcacgaatggagcggccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgcattccgccaggcgggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcatccgcttccgcgatgcaggcggtcgcgcgcgaa
atccaggaaagcgaaacgctcgtcaacgtcgaggagcgcgtcgcgaccgtcaacgagatc
ttccggttgcaggacgccgacgaatactcggccgccgagcggatctacctgtcgtcgagc
tcgcgcgcgtcgaacgcggcgctcgtgctcgcggcgagccgcggcaacgggctcgaggcc
gtcaccgaggacaagccgaaggtgatgctgccgatcgccggcaagccgctgttgcgctgg
ctcgtcgacggcttcaagaagcagggcgtgaacgacatcacggtcgtcggcggttatcgc
gccgatgcgatcgacacgtccggcgtgaagctcgtcgtcaacgagcggcacgcgcaaacc
ggcgagctcgcgtcgctcgcatgcgcggccgagcgtctcacgggcgacaccatcgtctcg
tacggcgatctgctgttccgcagctacatcctgcgcgacctcgccgagagcgaggccgag
ttcagcgtcgtcgtcgattcctcgcagacgcagccgtcgaaccagagcgtgcgcgatttc
gcgttctgctcggccgccgacgaccgcgggctgttcggccagaaagtgcatttgcgccgc
gtgtcgagcgatgcgagcgaagccgcgccgcacggccgctggatcggcctgctgaacgtg
cgcggcgcgggcgtcgcgcggctgaaggcgatgctcgacacgctgaaggcgcgcgacgat
ttcgattcgctcgatctgccggccctcctgaacgcgctcgtcgacgcgggcgagcggatc
gaggtgcaatacgtgcacggccactggcgaggcgtcaacgatctcgacgatttccgccgc
gcgggcgacttcgcgcacggccagacgccgtacgcggagcagaacgcgggcaacgggggc
gcgcgatga

DBGET integrated database retrieval system