KEGG   Burkholderia thailandensis H0587: BTL_5075Help
Entry
BTL_5075          CDS       T03113                                 

Definition
(GenBank) penicillin binding transpeptidase domain protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00550  Peptidoglycan biosynthesis
btz01100  Metabolic pathways
btz01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTL_5075
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BTL_5075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:btz01003]
    BTL_5075
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btz01011]
    BTL_5075
Enzymes [BR:btz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BTL_5075
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BTL_5075
Glycosyltransferases [BR:btz01003]
 Polysaccharide
  Bacterial polysaccharide
   BTL_5075
Peptidoglycan biosynthesis and degradation proteins [BR:btz01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BTL_5075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AHI68630
LinkDB All DBs
Position
2:complement(2163258..2165792)
Genome map
AA seq 844 aa AA seqDB search
MNRRIVSSILDRCAAWLAAAKPHAAAVLRRLRHPTRRGALLAVAAVPALGVLYVLALIPF
TPSIGDIRKARVDAPAQILSADGKLLAEFKPSNREWVPLADISPKMVDALISTEDHRFYE
HHGLDWRRTAGAALRTFSGDRQGGSTITQQLARNLYPDEIGRAPTLTRKLKEAITALKIE
AVYSKAQILETYLNTVPFLYNAYGVEMAARTYFDKSADQLDALDAATLVGMLKGNSYYNP
VLNPERALARRNTVLAQMVKYGKLSPAAYALLQKKPLRIDFERQKEPPGPAPHFAQQLRK
WLIAWADRNDYNIYSDGLVVRTTIDSRLQTYATQALARQTNQLQGIANGMWNAGSGCAPG
NPVFRAFVRETPEFRAALDGGAAEDAALKRLLADRAFTRALCKAKADVQAGFLAIDPRNG
QIKAWVGSRDFTTEPFDHVQQARRQPGSTFKPFVYGAAFAAGATPDDTFVDQPVEIALKG
GEIWRPDDDVPPTGKPMTLRDAIAYSRNRITAQLMMKVGPQKVARLARAMGVRDSELDAV
PSLALGTSPVTLKEMVSAYATIANVGEYVEPRMVTRIEDHNGDVLAEFASASPERALAAP
AARTLIDVMRGVVERGTGAAIRSRYGIRADVAGKTGTTQGDTDGWFILMQPELVAGAWVG
FDDGRVTLGSDWGQGARSALPIVGDFYQRAIRARLVDTRARFATEAPPSAFDTLRGKLND
WYRYLFEKPEPQKAAPPPKAPRAPVEEVMPASEVEAASEAAAAAARAASEAAASAALAAS
AASGAPFAPGGASAPAMPPLLPPPSPPSPPPAAQPDNGLPNDNAPMSPTPTPDAPAATGA
GGGN
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcgcagaatcgtgtcgtcaatcctcgaccgttgcgcggcctggctcgccgccgcg
aagccgcacgccgccgccgtccttcgccgcctgcgccatccgacgcggcgcggcgcgctg
ctcgccgtcgccgccgtccccgcgctgggcgtgctctacgtgctcgcgctgatcccgttc
acgccgagcatcggcgacatccgcaaggcgcgcgtcgacgcgcccgcgcagatcctgtcc
gccgacggcaagctgcttgccgagttcaagccgtcgaaccgcgaatgggtgccgctcgcc
gacatctcgccgaagatggtcgacgcgctgatctcgaccgaggatcatcgcttctacgag
caccacggcctcgactggcggcgcaccgcgggcgccgcgctgcgcacgttctcgggcgac
cggcagggcggctcgacgatcacgcagcagctcgcgcgcaacctgtatccggacgagatc
ggccgcgcgccgacgctcacgcgcaagctgaaggaagcgatcaccgcgctgaagatcgag
gcggtctacagcaaggcgcagatcctcgagacgtatctgaacacggtgccgttcctgtac
aacgcgtacggcgtcgagatggcggcgcgcacgtacttcgacaaatcggccgatcagctc
gacgcgctcgacgcggcgacgctcgtcggcatgctcaagggcaacagctactacaacccg
gtgctgaaccccgagcgcgcgctcgcgcgccgcaacacggtgctcgcgcagatggtgaag
tacggcaagctgtcgccggccgcgtatgcgctgctgcagaaaaagccgctgcgcatcgac
ttcgagcggcagaaggagccgcccggccccgcgccgcatttcgcgcagcaactgcgcaag
tggctgatcgcatgggccgatcgcaacgactacaacatctactcggacggcctcgtcgtg
cgcacgacgatcgattcgcggctgcagacgtacgcgacgcaggcgctcgcgcgtcagacg
aatcagttgcagggcatcgcgaacgggatgtggaacgcgggcagcggctgcgcgccgggc
aatccggtgttccgcgcgttcgtgcgcgagacgccggagtttcgcgcggcgctcgacggc
ggcgcggccgaggatgcggcgctcaagcgcctgctcgccgatcgcgccttcacgcgcgcg
ctgtgcaaggcgaaggccgacgtgcaggcgggctttctcgcgatcgatccgcgcaacggg
cagatcaaggcgtgggtcggcagccgcgatttcacgaccgagccgttcgatcacgtgcag
caggcgcgccgccagccgggctcgacgttcaagccgttcgtctacggcgcggcgttcgcg
gcgggcgcgacgcccgacgatacgttcgtcgatcagcctgtggagattgcgctcaagggc
ggcgagatctggcggcccgacgacgacgtgccgcccacgggcaagccgatgacgctgcgc
gacgcgatcgcgtattcgcgcaaccggatcaccgcgcaactgatgatgaaggtcggcccg
cagaaggtcgcgcggctagcgcgcgcgatgggcgtgcgcgacagcgagctcgacgcggtg
ccgtcgctcgcgctcggcacgagccccgtgacgctcaaggagatggtgtccgcgtacgcg
acgatcgcgaacgtcggcgaatacgtcgagccgcggatggtcacgcgcatcgaggaccat
aacggcgacgtgctcgccgagttcgcgagcgcgtcgcccgagcgcgcgctcgccgcgccg
gccgcgcgcacgctgatcgacgtgatgcgcggcgtcgtcgagcgcggcaccggcgcggcg
atccgctcgcgctacggcattcgcgcggacgtcgccggcaagacgggcacgacgcagggc
gacaccgacggctggttcatcctgatgcagcccgagctcgtcgcgggcgcgtgggtcggc
ttcgacgacggccgcgtgacgctcggcagcgactgggggcagggcgcgaggagcgcgctg
ccgatcgtcggcgatttctatcagcgggcgatacgcgcgcggctcgtcgatacgcgcgcg
cgcttcgcgaccgaagcgccgccgagcgcgttcgatacgttgcgcggcaagctcaatgac
tggtatcgctatctgttcgagaagcctgagccgcagaaggccgcgccgccgccgaaggcc
ccgcgcgcgccggtcgaggaggtgatgccggcctcggaggtcgaggcggcgtcggaggcg
gcggccgcggcggcgcgcgccgcgtccgaggcggcggcatccgccgccctcgccgcatcg
gcggcaagcggcgcgccgtttgcgccgggcggtgcgtccgcgccggcgatgccgccgctg
ttgccgccgccttcgccgccttcgccgccgcccgccgcgcagccggacaacggcttgccg
aacgacaacgcgccgatgtccccgacgccgacacccgatgcgcccgccgcgaccggcgcg
ggcggcggcaactag

DBGET integrated database retrieval system