KEGG   Burkholderia thailandensis H0587: BTL_5231
Entry
BTL_5231          CDS       T03113                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
btz  Burkholderia thailandensis H0587
Brite
KEGG Orthology (KO) [BR:btz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:btz02044]
    BTL_5231
Secretion system [BR:btz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BTL_5231
SSDB
Motif
Pfam: T6SS_VipA Big_12
Other DBs
NCBI-ProteinID: AHI68500
LinkDB
Position
2:2358652..2359191
AA seq 179 aa
MAISNSSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPIEPLPAVGDR
KFFSIDIDNFDERMKAMKPRVAFSVPNTLSGDGQLMVDITFESMDDFSPAAIAKKVGALS
QLLDARTQLANLQTYMDGKSGAENLVSKVLKDPALLSALAKAPKPAAEQAENRESKEKH
NT seq 540 nt   +upstreamnt  +downstreamnt
atggctatatccaatagctcacagaaatttatcgcgcgcaatcgtgcgcctcgcgtccag
atcgaatacgacgtcgagatttacggttccgaaaagaaagtcgagcttcctttcgtgatg
ggcgtgcttgcggacctgtcgggcaagccgatcgagcctttgccggctgtcggcgaccgc
aagttcttcagcatcgatatcgacaatttcgacgagcgcatgaaggcaatgaagccgcgt
gtcgcgttctcggtgccgaacaccctttccggcgacggtcagttgatggtcgacatcacg
ttcgaaagcatggacgacttttcccccgcggcgatcgcgaagaaggtgggcgcgttgtcg
caattgctggacgcacgcacgcagcttgccaatctgcagacctacatggacggaaagtcg
ggtgcggagaacctcgtgagcaaggtgctcaaggaccccgcgctgctcagcgcgctcgcg
aaggcgccgaagcctgcggcggaacaggcggaaaaccgggaatcgaaggaaaagcactga

DBGET integrated database retrieval system