KEGG   Burkholderia thailandensis H0587: BTL_5541Help
Entry
BTL_5541          CDS       T03113                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00010  Glycolysis / Gluconeogenesis
btz00071  Fatty acid degradation
btz00350  Tyrosine metabolism
btz00625  Chloroalkane and chloroalkene degradation
btz00626  Naphthalene degradation
btz01100  Metabolic pathways
btz01110  Biosynthesis of secondary metabolites
btz01120  Microbial metabolism in diverse environments
btz01130  Biosynthesis of antibiotics
btz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTL_5541
  Lipid metabolism
   00071 Fatty acid degradation
    BTL_5541
  Amino acid metabolism
   00350 Tyrosine metabolism
    BTL_5541
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTL_5541
   00626 Naphthalene degradation
    BTL_5541
Enzymes [BR:btz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BTL_5541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AHI66641
LinkDB All DBs
Position
2:2733226..2734251
Genome map
AA seq 341 aa AA seqDB search
MAQYMKAAVVHAFGEPLRIEEVPVPTPGPGQILVNIKASGVCHTDLHAADGDWPVKPTLP
FIPGHEGVGFVTAVGGGVKHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSV
NGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGL
GHVAVQYARAMGLHVVAVDVAHEKLELARKLGATFVVDASRDDPAAVIQKEIGGVHGVLV
TAVSRSAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAAEGLVRAHIHRDKLENINSVFTALREGKVDGRIVLTGE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaatacatgaaggccgcggtggtacacgcattcggcgaaccgcttcgcatcgag
gaagtccccgtgccgacgcctggcccgggccagatcctcgtgaacatcaaggcgtcgggc
gtgtgccataccgatctgcacgcggccgacggcgactggcccgtcaagccgacgctgccg
ttcattccggggcacgagggcgtcggcttcgtgacggcggtgggcggcggcgtcaagcac
gtgaaagagggcgatcgcgtcggcgtgccgtggctctataccgcatgcggccattgcgag
tattgccagaccggctgggaaacgctgtgccacgagcagcagaacaccggctattcggtg
aacggcagttatgcggaatacgtgctcgccgatccgaactacgtcggccatctgccgagc
aacgtcgcgttcgacgaaatcgcgccgatcctgtgcgcgggcgtgaccgtctacaagggc
attcgcgtgaccgatacgcgccccggccaatggatcgcgatctcggggatcggcgggctc
gggcacgtcgcggtccagtacgcgagggcgatggggctgcacgtcgtcgcggtcgacgtc
gcgcacgagaagctcgagcttgcgcgcaagctgggtgcgacgttcgtcgtcgacgcgtcg
agggacgatcccgccgcggtgatccagaaggagatcggcggcgtgcacggcgtgctcgtg
acggccgtgtcgcgcagcgcgttcgcgcaggcgctcggcatggtgcggcgaggcgggacg
gtatcgttgaacgggctgccgccgggggattttccgctgccgattttctcgacggtgctc
aacgggatcacggtgcgcggctcgatcgtcggcacgcggcgcgatcttcaggagtcgctc
gacttcgcggccgaagggctcgtgcgcgcgcatatccatcgcgacaagctggagaacatc
aatagcgtgttcacggcgctgcgcgaagggaaggtcgacgggcggatcgtgttgaccggg
gagtga

DBGET integrated database retrieval system