KEGG   Burkholderia thailandensis H0587: BTL_5597Help
Entry
BTL_5597          CDS       T03113                                 

Definition
(GenBank) ring hydroxylating alpha subunit family protein
  KO
K16319  anthranilate 1,2-dioxygenase large subunit [EC:1.14.12.1]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00627  Aminobenzoate degradation
btz01100  Metabolic pathways
btz01120  Microbial metabolism in diverse environments
Module
btz_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTL_5597
Enzymes [BR:btz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     BTL_5597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A
Motif
Other DBs
NCBI-ProteinID: AHI68505
LinkDB All DBs
Position
2:2794556..2795833
Genome map
AA seq 425 aa AA seqDB search
METTESPVLPIDRADSSDVRFPHDDGSRVPYKVFSSQAVYDREQERIFRGPTWNFVALEA
EIPKPGDFKSTFVGDTPVVVTRDEDGALAAWVNRCAHRGAQVCRQARGNASSHTCVYHQW
SFDSCGNLLGVPFRRGQKGMTGMPADFDPKNHGLRKLRVDSYKGLVFATFSDDVAPLPDY
LGPQMRPWIDRIFHKPIEYLGCTRQYSKSNWKLYFENVKDPYHASMLHLFHTTFNIFRVG
MKARSIPDATHGLHSIITMTKTREDTDTASAYRQQNIRSFDEGFSLEDDSILGLVSEYDE
DTTNHIQPIFPQLVIQQIHNTLVARQLLPKGPKNFELIFHFFGYADDTPELRDLRIKQAN
LVGPAGYISMEDTEATELVQRGTARDADAASVIEMSRGNPDQQDTAITESLIRKFWVGYQ
KLMGY
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaccgaatcgccggtattgccgatcgatcgcgccgattcgtccgacgtgcga
ttcccgcacgacgacggctcgcgcgtgccgtacaaggtgttcagctcgcaagcggtgtac
gaccgcgagcaggagcggatctttcgcgggccgacgtggaatttcgtcgcgctcgaagcg
gaaatcccgaaaccgggcgacttcaagagcacgttcgtcggcgacacgcccgtcgtcgtc
acgcgcgacgaggacggcgcgctcgccgcttgggtgaaccgctgcgcgcatcgcggcgcg
caggtgtgccgccaggcgcgcggcaacgcgagctcgcacacctgcgtctaccaccagtgg
agcttcgatagctgcggcaacctgctcggcgtgccgtttcggcgcgggcagaagggcatg
accgggatgccggccgatttcgatccgaagaatcacgggctgcgcaagctgcgcgtcgac
agctacaagggcctcgtgttcgcgacgttcagcgacgacgtcgcgccgttgcccgactac
ctcggcccgcagatgcggccgtggatcgaccggatcttccacaagccgatcgagtatctc
ggctgcacgcgccagtattcgaaatcgaactggaagctgtacttcgagaacgtgaaggac
ccgtatcacgcgagcatgctgcatctgttccatacgacgttcaatattttccgagtcggg
atgaaggcgcgctcgattccggacgcgacgcacgggctgcacagcatcatcacgatgacg
aagacgcgcgaggacacggataccgcgagcgcgtacaggcagcagaacatccgttcgttc
gacgaaggtttctcgctcgaggacgactcgatccttggcctcgtgtccgagtacgacgag
gacacgacgaaccacatccagccgatctttccgcagctcgtgatccagcagatccacaac
acgctcgtcgcgcgccagttgctgccgaaagggccgaagaacttcgagctgatctttcac
ttcttcggctacgcggacgatacgcccgagctgcgcgatttgcggatcaagcaggcgaac
cttgtcgggcccgcgggctacatctcgatggaggacaccgaggcgaccgagctcgtccag
cgcggcacggcgcgcgatgcggatgcggcatcggtgatcgagatgtcgcgcggcaatccg
gaccagcaggacacggcgatcaccgagagcctgatccgcaagttctgggtcggctaccag
aagctgatgggctattga

DBGET integrated database retrieval system