KEGG   Burkholderia thailandensis H0587: BTL_792Help
Entry
BTL_792           CDS       T03113                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00473  D-Alanine metabolism
btz00550  Peptidoglycan biosynthesis
btz01100  Metabolic pathways
btz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BTL_792
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTL_792
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BTL_792
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btz01011]
    BTL_792
Enzymes [BR:btz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BTL_792
Peptidoglycan biosynthesis and degradation proteins [BR:btz01011]
 Precursor biosynthesis
  Amino acid ligase
   BTL_792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp TTL ATP-grasp_3 ATP-grasp_4 ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-ProteinID: AHI64485
LinkDB All DBs
Position
1:856529..857467
Genome map
AA seq 312 aa AA seqDB search
MSGIDPKRFGKVAVLLGGESAERDVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPP
FETVMRGDDYAARAKDIVAKLGMPLFVKPASEGSSVAVEKVKSADALPAALEEAAKHDKI
VIVEKSIEGGGEYTACIAADLDLPLIKIVPAGEFYDYHAKYIANDTQYLIPCGLDAAKEA
EFKRIARRAFDVLGCTDWGRADFMLDAAGNPYFLEVNTAPGMTDHSLPPKAARAVGISYS
ELVVKVLSLTLD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcggtgctgctcggcggggaatcc
gccgagcgcgatgtgtcgctgaactccggccggctggtgctgcagggcttgcgcgacgca
ggcatcgacgcgcatccgttcgatccggcgcagcggccgctcgcggcgctcaaggacgaa
ggcttcgtgcgcgcgttcaacgcgttgcacggcggttacggcgagaacggtcagatccag
ggcgcgctcgatttctacggcatccgctacacgggcagcggcgtgctcggctcggcgctc
gggctcgacaagttccgcacgaagctcgtctggcagcagacgggcattccgacgccgccg
ttcgagacggtgatgcgcggggacgactacgcggcgcgcgcgaaggacatcgtcgcgaag
ctcggcatgccgctcttcgtgaagccggcgagcgagggctcgagcgtcgcggtcgagaag
gtgaaaagcgccgatgcgttgcccgccgcactggaagaagcggcgaagcacgacaagatc
gtgatcgtcgagaagagcatcgaaggcggcggcgaatacaccgcgtgcatcgccgccgat
ctcgatctgccgctcatcaagatcgtgcctgcaggcgagttctacgactatcacgcgaag
tacatcgcgaacgacacgcaatatctgattccgtgcggcctggatgcggcaaaggaagcc
gagttcaagcgcatcgcgcgccgtgcgttcgacgtgctcggctgcacggattgggggcgc
gcggatttcatgctcgatgccgcaggcaacccgtatttcctcgaagtgaacaccgcgccg
gggatgaccgatcactcgctgccgccgaaggcggcgcgcgcggtcggcatcagctattcg
gagctggtggtgaaagtgctgtcgctcacgctcgattga

DBGET integrated database retrieval system