KEGG   Buchnera aphidicola LL01 (Acyrthosiphon pisum): CWO_01150Help
Entry
CWO_01150         CDS       T01828                                 

Definition
(GenBank) cell division protein FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
bua  Buchnera aphidicola LL01 (Acyrthosiphon pisum)
Pathway
bua00550  Peptidoglycan biosynthesis
bua01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bua00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CWO_01150
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CWO_01150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bua01011]
    CWO_01150
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bua03036]
    CWO_01150
Enzymes [BR:bua01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CWO_01150
Peptidoglycan biosynthesis and degradation proteins [BR:bua01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CWO_01150
Chromosome and associated proteins [BR:bua03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    CWO_01150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ADP66044
LinkDB All DBs
Position
complement(245243..246982)
Genome map
AA seq 579 aa AA seqDB search
MYKKEKNRFLKSKQINYINWRFFLLYGFIFLSLFILTLRVIFLQIISSNRLITEGDRRTL
RTQSLLSTRGAIKDRRGYPLAVTVLVNAICADPSVILKTKNIKNHKRWQALSEILSIPLK
KMFLRINSHKKSKFIYLARQINPEISEYIKKLQLPGIFLLEESKRYYPFKEISAQLVGFT
NIDGIGIEGIEKSFDLLLTGKPGKRKIRQDNKGHVIEKISLVHKRASNNLNLSIDTKLQT
IVYNELQEGVKKSQSDSGTAILINIKSGEVLAMANSPSYNPNNTRHIIQKNVRNKAITDL
FEPGSTVKPIVIIEALKLGIIQENSIIDTKPFLIQKHQIKDVSYHEKLTITGILQKSSNV
GVSKIALSMPTLKLLDSYIKFGLGKPTQLGLIGEKHGFFPPKKRWSNLDKATLSFGYGLM
VTPLQLARLYSTIASYGIYRPLSIIKTDRPTGGKQIFPPKYVKKVINMMESVSQPGGGGL
QAAVRGYRVAVKTGTAKKVGIHGRYIKKYTAYTAGIAPASDPRFSLIIILDNPQGKKYYG
GAVSAPVFSNIMKLILKKMNIKPDNLSNKKMILKSNKRN
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaaaagaaaaaaatagatttttaaaatcaaaacaaataaattatataaattgg
cgtttttttttattatatggctttatttttttgtccctgtttattttaacacttcgcgta
atttttttacaaattatcagttctaatcgattaataacagaaggagatcgtcgaacatta
agaacacaatctttacttagtacaagaggtgcaattaaggatcgaagaggttatccgtta
gcagttactgtattagtaaacgcaatttgtgcagatccatcagtaattctaaaaacaaaa
aatattaaaaaccataaacgttggcaagctttatcagaaattctttctattcctttaaaa
aaaatgtttctacgtataaattctcataaaaaatcaaaatttatttacttagctcgtcaa
attaatcctgaaatttcagaatatattaaaaaattacagttacctggcatttttttatta
gaagaatcaaaaagatactatccatttaaagaaatttcagctcaactagtaggttttact
aatatagatggaatagggattgaaggaatagaaaaaagcttcgatttattattaacagga
aaaccaggaaaaagaaaaataagacaagataataaaggacatgttattgaaaaaatatct
ttagttcataaacgagcatctaataacttaaatcttagcattgatacaaaattacaaact
attgtatataatgaattacaagaaggggttaaaaaaagccaatctgattctggaactgca
attttaattaacattaaatcaggagaggttctagctatggcaaatagtccttcatataat
cctaataatacacgacatatcatacaaaaaaatgttcgtaataaagcaattacagatctt
tttgaacctggctcaacagtaaaaccaatagtcattatagaagcgttaaaacttggaata
atacaagaaaattcaattattgatacaaaaccttttttaattcaaaaacatcaaataaaa
gatgtatcctatcatgaaaaacttacgataactggtatattgcaaaaatcaagtaacgtg
ggtgtgtcaaaaattgcactatccatgccaactttaaaattactcgatagttatattaaa
tttggattaggtaaacctactcaactaggattaataggagaaaaacatggttttttccct
cctaaaaaaaggtggtctaatttagataaagctactttgtcttttggatacggacttatg
gtaactccacttcagttagcaagattatattctactattgctagttatggaatatatcgt
ccactttcaattataaaaactgaccgtccaacaggcggaaaacaaattttccccccaaaa
tatgtcaaaaaagtaattaatatgatggaaagtgtttctcaaccaggtggaggaggtctt
caagcggcagtccgaggatatcgtgttgctgtaaaaacagggactgcaaaaaaagtagga
attcatgggcgttatattaaaaaatacacagcttatacagcaggaattgcaccagctagc
gatccaagattttcattgataattattctcgataatcctcaaggaaaaaaatattatgga
ggagcggtttctgctccagtttttagtaatataatgaaactaatattaaaaaaaatgaat
ataaaaccagataacttgtcaaataaaaaaatgattttaaaatcaaataaaaggaactga

DBGET integrated database retrieval system