KEGG   Buchnera aphidicola LL01 (Acyrthosiphon pisum): CWO_01385Help
Entry
CWO_01385         CDS       T01828                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bua  Buchnera aphidicola LL01 (Acyrthosiphon pisum)
Pathway
bua00061  Fatty acid biosynthesis
bua00780  Biotin metabolism
bua01100  Metabolic pathways
bua01130  Biosynthesis of antibiotics
bua01212  Fatty acid metabolism
Module
bua_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bua00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CWO_01385
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CWO_01385
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CWO_01385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bua01004]
    CWO_01385
Enzymes [BR:bua01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CWO_01385
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CWO_01385
Lipid biosynthesis proteins [BR:bua01004]
 Fatty acid synthase
  Component type
   CWO_01385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short TIR_3 KR
Motif
Other DBs
NCBI-ProteinID: ADP66085
LinkDB All DBs
Position
291647..292429
Genome map
AA seq 260 aa AA seqDB search
MGFLKGKKFLIIGISSVRSIAFGIAKSLYNQKAELGFVCQNEKIRKKIKKLVEPMKSCIV
LCCDVSNDKNIKKLFIDLGQVWKKFDGLVHAIAYCPKQYFNGDFIDNITREGFNISHEIS
SYSFIGLVKACRTMLNNFSSLLTLSYLGSQRVVPNYNVMGLAKASLEASVRYMASSLGKE
NIRVNAISSSPIKTISSYKITNFNKIRNCSYASSFLKNSVTSENIGNVASFLLSDLSLGI
TGSVIYVDNGFNVSSMNNIQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggatttttaaaaggtaaaaaatttttaataattggcatttcaagtgtacgatcaatt
gcttttggtatagcaaaatctttatataatcagaaagctgaattaggatttgtatgccaa
aatgaaaaaatcagaaaaaaaataaaaaaactcgtagaaccaatgaaatcttgtatcgta
ctatgttgtgacgtttctaatgataaaaatattaaaaaattatttatagatttaggtcag
gtatggaagaaatttgacggattagttcatgcaattgcttattgtccaaagcaatatttt
aatggagattttattgataatattaccagagaaggttttaatatttctcatgaaattagt
tcttatagttttataggattggttaaagcttgcagaacaatgttaaacaatttttcttct
ttattgactttatcttatttaggttcacaacgtgtcgtgcctaattataatgttatgggt
ttagctaaagcttcattagaagcaagtgtccgttatatggctagttcattaggaaaagaa
aatattcgtgtcaacgctatttcgtctagtcctattaagactatttcctcttataaaatt
acaaattttaataaaatacgaaattgttcttatgcatcttcttttttaaaaaattctgtt
accagtgaaaatataggaaatgtagcatcctttttattgtctgatttgtctttaggtatt
actggttcagttatttatgttgacaatggttttaatgtcagcagcatgaataatattcaa
taa

DBGET integrated database retrieval system