KEGG   Burkholderia ubonensis: BW23_1093Help
Entry
BW23_1093         CDS       T03794                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
bub  Burkholderia ubonensis
Brite
KEGG Orthology (KO) [BR:bub00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BW23_1093
Enzymes [BR:bub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     BW23_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 Methyltransf_11 zf-CXXC
Motif
Other DBs
NCBI-ProteinID: AJX18044
LinkDB All DBs
Position
I:complement(1173497..1174555)
Genome map
AA seq 352 aa AA seqDB search
MRMRCMCVVIHGPNDLRLEEQDPGGIGPGQVRVDVAMGGICGSDLHYFRHGGFGTVRLQQ
PMVLGHEVAGTVAVVAPDVTSVQVGDRVAVDPSRPCGACRYCVEGLPNQCLDMCFYGSAM
RMPHVQGAFRNALVCDARQCVKVADHVPLSLAALAEPFAVGLHAVSRAGPLIGRRVLVSG
CGPIGALAVAAARAHGAAEVVATDVVDEPLAIARALGADRTINAATDTTWVARHAADKGT
FDVMLECSGNARALRDGLDVMRPRGVVVQLGLGGDVSLPQNVVVAKELSICGSFRFHSEF
ALAVQLINESRVDLRPAVTGVFPMRDAGRAFELAGDRRRAMKVLIDFADDAA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatgcgttgcatgtgtgtcgtgatccacgggccgaacgacctgcggctcgaggag
caggacccgggcgggatcggcccgggccaggtgcgggtcgacgtcgcgatgggcggcatc
tgcgggtccgacctgcattatttccggcacggcgggttcgggacggtgcgcctgcagcag
ccgatggtgctcgggcacgaggtggccggcacggtggccgtggtcgcgccggacgtgacg
tcggtgcaggtcggcgaccgcgtcgccgtcgatccgagccggccgtgcggcgcatgccgc
tactgcgtcgaaggcttgccgaaccagtgtctcgacatgtgcttctacggcagcgcgatg
cggatgccgcacgtgcagggcgcgttccgcaacgcgctggtgtgcgacgcgcgccagtgc
gtgaaggtcgcggatcacgtgccgctgtcgctcgccgcgctcgcggagccgttcgcggtc
ggcctgcacgcggtgtcgcgcgccggtccgctgatcggccgccgcgtgctggtgtccggc
tgcgggccgatcggcgcgctggccgtggcggccgcccgcgcgcacggcgcggcggaagtg
gtcgcgactgacgtcgtcgacgagccgctcgcgatcgcgcgcgcgctcggcgccgaccgc
acgatcaacgcagcgaccgatacgacgtgggtcgcgcgccatgccgcggacaagggcacg
ttcgacgtgatgctcgaatgctcgggcaacgcgcgcgcactgcgcgacgggctggacgtg
atgcgcccgcgcggcgtcgtcgtgcagctcgggctcggcggcgacgtgagcctgccgcag
aacgtcgtggttgcgaaggagctgtcgatctgcgggtcgttccgcttccattcggagttc
gcgctggccgtgcagctgatcaacgaaagccgcgtcgacctgcggcccgccgtgaccggc
gtgttcccgatgcgcgacgcgggccgcgcgttcgagctggcgggcgaccggcggcgcgcg
atgaaggtgctgatcgatttcgcggacgacgcggcgtga

DBGET integrated database retrieval system