KEGG   Burkholderia ubonensis: BW23_1184Help
Entry
BW23_1184         CDS       T03794                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bub  Burkholderia ubonensis
Pathway
bub00473  D-Alanine metabolism
bub00550  Peptidoglycan biosynthesis
bub01100  Metabolic pathways
bub01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BW23_1184
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BW23_1184
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BW23_1184
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bub01011]
    BW23_1184
Enzymes [BR:bub01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BW23_1184
Peptidoglycan biosynthesis and degradation proteins [BR:bub01011]
 Precursor biosynthesis
  Amino acid ligase
   BW23_1184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 TTL ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-ProteinID: AJX17217
LinkDB All DBs
Position
I:complement(1274210..1275151)
Genome map
AA seq 313 aa AA seqDB search
MSGIDPKRFGKVAVLLGGVSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAERPLAALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPP
FETVLRGDDLAARAPEIVAKLGLPLFVKPASEGSSVAVLKVKTADALPAALAEAAKHDPI
VIVEKSIEGGGEYTACIAGDLDLPVIKIVPAGEFYDYHAKYIADDTQYLIPCGLAADKEA
ELKRIARRAFDVLGCTDWGRADFMLDANGDAYFLEVNTAPGMTDHSLPPKAARAVGISYS
ELVVKVLSLTLND
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggattgatccgaaacgtttcggcaaggtggcggtgttgctcggcggcgtgtcc
gccgagcgcgaggtgtcgctcaactcgggccggctcgtgctgcagggcctgcgcgacgcg
ggcatcgacgcgcatccgttcgacccggccgagcgtccgctggcggcgctgaaggacgaa
gggttcgtgcgcgcgttcaacgcgctgcacggcggctatggcgagaacggccagatccag
ggcgcgctcgatttctacggcatccgctacacgggcagcggcgtgctcggctcggcgctc
ggcctcgacaagttccgcacgaagctcgtgtggcagcagacgggcgtgccgacgccgccg
ttcgagacggtgctgcgcggcgacgacctcgccgcgcgcgcgccggagatcgtcgcgaag
ctcggcctgccgctgttcgtgaagccggcgagcgaaggctcgagcgtcgcggtgctgaag
gtgaagacggccgacgcgttgccggctgcgctcgccgaagccgcgaagcacgacccgatc
gtgatcgtcgagaagagcatcgagggcggcggcgaatacaccgcgtgcatcgccggcgat
ctcgacctgcccgtgatcaagatcgtgccggccggcgagttctacgactatcacgcgaag
tacatcgccgacgacacgcaatacctgattccgtgcggcctcgccgccgacaaggaagcg
gagctgaagcgcatcgcgcgccgggcgttcgacgtgctgggctgcaccgactggggccgc
gcggacttcatgctcgacgccaacggcgacgcgtacttcctggaggtgaacaccgcgccg
ggcatgaccgatcactcgctgccgccgaaggcggcgcgcgcggtcggcatcagctattcg
gagctggtggtgaaggtgctgtcgctcacgctcaacgactga

DBGET integrated database retrieval system