KEGG   Burkholderia ubonensis: BW23_1769Help
Entry
BW23_1769         CDS       T03794                                 

Definition
(GenBank) sel1 repeat family protein
Organism
bub  Burkholderia ubonensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sel1
Motif
Other DBs
NCBI-ProteinID: AJX16411
LinkDB All DBs
Position
I:1911972..1912724
Genome map
AA seq 250 aa AA seqDB search
MNASAGACRRNCARALRAGGAALGLWAVCGAAFAQGARAQPEPARETESAIADYNAGNFR
AALVQFHDAAERGNRLAQFNYAMMLITGEGVTANVDEGLRWLRRAADANMSHAQYVYGRM
LDDGDFVARNPAEAHRWFLKAAKQGHVQAALSLANQFLDGRGTPRDNRQAFVWYKQAADA
GDPTAQYVTASFYERGGDGVEQNLNIARAYYAAAAAQGDETAGLKFKELSERVKAQGPAS
GGGAGAAPPQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaagcgccggcgcgtgtcgccgcaactgcgcgcgcgcgctgcgggcgggcggc
gcggcgctcggcctgtgggccgtctgcggcgcggcgttcgcgcagggcgcgcgagcgcag
ccggagccggcgcgcgagacggagtccgcgatcgccgattacaacgcgggcaatttccgg
gcggcgctcgtgcagtttcacgatgcggccgagcgtggcaaccgtctcgcgcagttcaat
tacgcgatgatgctgatcacgggcgagggcgtgacggcgaacgtcgacgaggggctgcgc
tggctgaggcgcgcggccgacgcgaacatgtcgcacgcgcagtacgtgtacggccggatg
ctggacgacggcgatttcgtcgcgcgcaatccggccgaggcgcatcgctggttcctgaag
gcggcgaagcagggccacgtgcaggccgcgctgtcgctcgcgaaccagttcctcgacggg
cgcggcacgccgcgcgacaaccgccaggcgttcgtctggtacaagcaggccgccgacgcg
ggcgatccgaccgcgcaatacgtgaccgcgtcgttctacgagcgcggcggcgacggcgtc
gagcagaacctgaacatcgcgcgcgcgtactacgcggcggccgccgcgcagggcgacgag
accgcgggactcaaattcaaggaactcagcgaacgcgtgaaggcgcagggcccggcgagc
ggcggcggtgccggcgcggcgccgccgcaatga

DBGET integrated database retrieval system