KEGG   Burkholderia ubonensis: BW23_1992Help
Entry
BW23_1992         CDS       T03794                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase family protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bub  Burkholderia ubonensis
Pathway
bub00550  Peptidoglycan biosynthesis
bub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bub00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BW23_1992
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bub01002]
    BW23_1992
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bub01011]
    BW23_1992
Enzymes [BR:bub01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BW23_1992
Peptidases and inhibitors [BR:bub01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BW23_1992
Peptidoglycan biosynthesis and degradation proteins [BR:bub01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BW23_1992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AJX15047
LinkDB All DBs
Position
I:2145829..2147145
Genome map
AA seq 438 aa AA seqDB search
MRLSSQGLKSLASSIAFGTAARNVALGVMLPVALASTIVAAEAKPAAKAKAAHAAPAAAP
EATGAPATYMPGAVPPPGVNARSWVLVDATSNTVLASGNADERVEPASLTKLMTAYLVFE
ALDKKKISMEQIVTPSAAVRRVGTDESRMFIEADKPVSVHDLVYGMIIQSGNDAAIALAE
LVGGSEAQFVNMMNDEARRLGMKGTHFADVNGMPDPNHYTTAGDLATLSAHLIRDFPQYY
SIFSEKEFKYNNIRQGNRNRLLWLDPTVDGLKTGHTQAAGFCLISSAKRQMPGTADAPRR
LVSVMMGETKESDRTQDSMKMLNYGYSAFDAVRLFKGGQAISTPRLYKGKSNNVQVGVKG
DQWVTVPRGLGDKVKTEVEVNAPLIAPLADGQPVGTVKIVADGKTLSQFPVVALQAVPEA
GIFGRIWDSILLMFSKKK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgtcctcccaaggcctcaagtccctcgcttcctccatcgccttcggcaccgcc
gcgcgcaacgtcgcgctcggcgtgatgctgcccgtcgcgctcgcgtcgacgatcgtcgct
gccgaggcgaagcccgccgccaaggccaaggcagcgcatgccgcgccggccgccgcgccc
gaggcgaccggcgcgcccgcgacctacatgccgggcgcggtgccgccgccgggcgtgaac
gcgcgctcgtgggtgctcgtcgacgcgacgagcaacaccgtgctcgcgtcgggcaacgcg
gacgagcgcgtcgagccggcgtcgctgacgaagctgatgaccgcgtacctcgtgttcgag
gcgctcgacaagaagaagatctcgatggagcagatcgtcacgccgagcgcagcggtgcgc
cgcgtcggcaccgacgagtcgcggatgttcatcgaggcggacaagccggtgtcggtgcac
gacctcgtgtacgggatgatcatccagtcgggcaacgacgcggcgatcgcgctcgccgag
ctggtcggcggcagcgaggcgcagttcgtcaacatgatgaacgacgaggccaggcgcctc
ggcatgaagggcacgcacttcgccgacgtgaacggcatgcccgacccgaaccactacacg
acggccggcgatctcgcgacgctgtccgcgcacctgatccgcgattttccgcagtactac
agcatcttctcggagaaggaattcaagtacaacaacatccgccagggcaaccgcaaccgc
ctgctgtggctcgacccgacggtcgacggcctgaagaccggccatacgcaggcagcgggc
ttctgcctgatctcgtcggcgaagcggcagatgccgggcacggcggatgcgccgcgccgc
ctcgtgtcggtgatgatgggcgagaccaaggaaagcgaccgcacgcaggacagcatgaag
atgctgaactacggctacagcgcgttcgatgcggtgcgcctgttcaagggcggccaggcg
atctcgacgccgcgcctctacaagggcaagagcaacaacgtgcaggtcggcgtgaagggc
gaccagtgggtgacggtgccgcgcggcctcggcgacaaggtgaagaccgaggtcgaggtg
aacgcgccgctgatcgcgccgctcgcggacggccagccggtcggcacggtgaagatcgtc
gccgacggcaagacgctgtcgcagttcccggtcgtcgcgctgcaggcggtgccggaagcg
ggtatcttcggtcgcatctgggactcgatcctgctgatgttcagcaagaagaagtaa

DBGET integrated database retrieval system