KEGG   Burkholderia ubonensis: BW23_2362Help
Entry
BW23_2362         CDS       T03794                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bub  Burkholderia ubonensis
Pathway
bub01100  Metabolic pathways
bub01110  Biosynthesis of secondary metabolites
bub01120  Microbial metabolism in diverse environments
bub01130  Biosynthesis of antibiotics
bub01200  Carbon metabolism
bub01210  2-Oxocarboxylic acid metabolism
bub01230  Biosynthesis of amino acids
Module
bub_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bub_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BW23_2362 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BW23_2362 (icd)
Enzymes [BR:bub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BW23_2362 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AJX16434
LinkDB All DBs
Position
I:2540698..2541954
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPDGGDKITVNQDYTLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVERAYK
GKRKIHWMEIYAGEKATKVYGPDVWLPDETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPVREPQKIDMVIFRENSEDIYAGIEWAAGSEQAKKVIQF
LQDEMGVKKIRFPETSGIGVKPVSTEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGGELIDGGPWMRVKNPKTGGEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADTIIAAMEKSIQQKRVTYDFARLMEGATQVSCSGFGEVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggacggcggtgacaagatcaccgtcaaccaggat
tacacgctcaacgtttccgaccagccgatcattccgtacatcgaaggcgacggcacgggc
ttcgacatcacgccggtcatgatcaaggtggtcgacgccgcggtcgaacgggcgtacaag
ggcaagcgcaagatccactggatggagatctacgcgggcgagaaggcgacgaaggtctac
ggcccggacgtgtggctgccggacgagacgctgcaggtgctgaaggaatacgtggtgtcg
atcaaggggccgctgacgaccccggtcggcggcggcatccgctcgctgaacgtcgcgctg
cgccaggagctcgacctgtacgtgtgcctgcgcccggtccagtacttcaagggcgtgccg
tcgccggtgcgcgagccgcaaaagatcgacatggtgatcttccgcgagaactcggaagac
atctacgcgggcatcgaatgggcggccggctcggagcaggcgaagaaggtcatccagttc
ctgcaggacgagatgggcgtgaagaagatccgcttcccggaaacctcggggatcggcgtc
aagcccgtgtcgacggaaggcaccgagcggctcgtgcgcaaggcgatccagtatgcgatc
gacaacgaccgcaagtcggtcacgctggtgcacaagggcaacatcatgaagttcacggaa
ggcctgttccgtgacgccggctacgcgctcgcgcagaaggagttcggcggcgagctgatc
gacggcggcccgtggatgcgcgtgaagaacccgaagacgggcggcgagatcgtcatcaag
gactcgatcgccgacgcgttcctgcagcagatcctgctgcgcccggccgaatacgacgtg
atcgcgacgctgaacctgaacggcgactacatctccgacgcgctggccgcgcaggtcggc
ggcatcggcatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaggcgacc
cacggcaccgcgccgaagtacgcgggcaaggattacgtgaaccccggttccgagatcctg
tcggccgaaatgatgctgcgccatctcggctggaccgaggcggccgacaccatcatcgcc
gcgatggaaaagtcgatccagcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaggtgtcgtgctcgggcttcggtgaagtgctgatcgagaacatgtaa

DBGET integrated database retrieval system