KEGG   Burkholderia ubonensis: BW23_2362Help
Entry
BW23_2362         CDS       T03794                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bub  Burkholderia ubonensis
Pathway
bub00020  Citrate cycle (TCA cycle)
bub00480  Glutathione metabolism
bub01100  Metabolic pathways
bub01110  Biosynthesis of secondary metabolites
bub01120  Microbial metabolism in diverse environments
bub01130  Biosynthesis of antibiotics
bub01200  Carbon metabolism
bub01210  2-Oxocarboxylic acid metabolism
bub01230  Biosynthesis of amino acids
Module
bub_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bub_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BW23_2362 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BW23_2362 (icd)
Enzymes [BR:bub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BW23_2362 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AJX16434
LinkDB All DBs
Position
I:2540698..2541954
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPDGGDKITVNQDYTLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVERAYK
GKRKIHWMEIYAGEKATKVYGPDVWLPDETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPVREPQKIDMVIFRENSEDIYAGIEWAAGSEQAKKVIQF
LQDEMGVKKIRFPETSGIGVKPVSTEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGGELIDGGPWMRVKNPKTGGEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADTIIAAMEKSIQQKRVTYDFARLMEGATQVSCSGFGEVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggacggcggtgacaagatcaccgtcaaccaggat
tacacgctcaacgtttccgaccagccgatcattccgtacatcgaaggcgacggcacgggc
ttcgacatcacgccggtcatgatcaaggtggtcgacgccgcggtcgaacgggcgtacaag
ggcaagcgcaagatccactggatggagatctacgcgggcgagaaggcgacgaaggtctac
ggcccggacgtgtggctgccggacgagacgctgcaggtgctgaaggaatacgtggtgtcg
atcaaggggccgctgacgaccccggtcggcggcggcatccgctcgctgaacgtcgcgctg
cgccaggagctcgacctgtacgtgtgcctgcgcccggtccagtacttcaagggcgtgccg
tcgccggtgcgcgagccgcaaaagatcgacatggtgatcttccgcgagaactcggaagac
atctacgcgggcatcgaatgggcggccggctcggagcaggcgaagaaggtcatccagttc
ctgcaggacgagatgggcgtgaagaagatccgcttcccggaaacctcggggatcggcgtc
aagcccgtgtcgacggaaggcaccgagcggctcgtgcgcaaggcgatccagtatgcgatc
gacaacgaccgcaagtcggtcacgctggtgcacaagggcaacatcatgaagttcacggaa
ggcctgttccgtgacgccggctacgcgctcgcgcagaaggagttcggcggcgagctgatc
gacggcggcccgtggatgcgcgtgaagaacccgaagacgggcggcgagatcgtcatcaag
gactcgatcgccgacgcgttcctgcagcagatcctgctgcgcccggccgaatacgacgtg
atcgcgacgctgaacctgaacggcgactacatctccgacgcgctggccgcgcaggtcggc
ggcatcggcatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaggcgacc
cacggcaccgcgccgaagtacgcgggcaaggattacgtgaaccccggttccgagatcctg
tcggccgaaatgatgctgcgccatctcggctggaccgaggcggccgacaccatcatcgcc
gcgatggaaaagtcgatccagcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaggtgtcgtgctcgggcttcggtgaagtgctgatcgagaacatgtaa

DBGET integrated database retrieval system