KEGG   Burkholderia ubonensis: BW23_239Help
Entry
BW23_239          CDS       T03794                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bub  Burkholderia ubonensis
Pathway
bub00020  Citrate cycle (TCA cycle)
bub00310  Lysine degradation
bub00380  Tryptophan metabolism
bub01100  Metabolic pathways
bub01110  Biosynthesis of secondary metabolites
bub01120  Microbial metabolism in diverse environments
bub01130  Biosynthesis of antibiotics
bub01200  Carbon metabolism
Module
bub_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bub_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BW23_239 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BW23_239 (sucA)
   00380 Tryptophan metabolism
    BW23_239 (sucA)
Enzymes [BR:bub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BW23_239 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AJX16883
LinkDB All DBs
Position
I:complement(264209..267073)
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYDAYLDNPASVPENWREYFDALQNVPATDGTSASD
VAHFPIVESFAQRAKANAFIPRESGANLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEADLDQTFSASNLYLGFDQASLRDIVKGLRDTYCGTIGAEYMYI
SDPEQKRWWQERLESTRATPNFTVDKKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIAAMDEVVQHSGKKGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDEDGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVILATQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVISAEDADGFVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWVPFLNRKWTDAADTAVPLAELKRLGERITTVPENFKVHPLVERVINDRRNMARGDQPL
DWGMAEHLAFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNVAD
NQAKFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGETDGGIDAKKVKRVLVCSGRVYF
DLVAHRREAKANDVAIIRIEQLYPFAHKQFEAELKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagtttcagctgaactcgtatctgttcggcggcaatgcttcg
tacgtagaagaactgtacgatgcatatctcgataatccggcgtcagtgcccgagaactgg
cgagagtatttcgatgcgctgcagaacgtgcccgcgacggacggtacgagtgccagcgac
gtcgcgcatttcccgatcgtcgagtcgtttgcgcagcgcgcgaaggccaatgccttcatc
ccgcgcgaaagcggcgccaatctggctacggcgcgcaagcaagtccacgtccagtccctc
atcagcgcatatcgcttccttggctcgcaatgggccaatctcgatcccctgaagcgtcgc
gaacgtcccgccattcccgaactcgaacccgcgttctacgacttctccgaggccgacctc
gaccagacgttcagcgcgagcaacctgtacctcggtttcgaccaggcttcgttgcgtgac
atcgtcaagggtctgcgcgacacgtactgcggcacgatcggcgctgagtacatgtacatc
agcgatcccgagcagaagcgctggtggcaggagcgcctggaatcgacccgcgcgacgccg
aatttcacggttgacaagaagaagcacatcctgaaccgcctgacggctgccgaaggcctc
gagcgctacctgcacaccaagtacgtcggccagaagcgcttctcgctggaaggcggcgaa
agcttcatcgcggcgatggacgaagtcgtccagcactcgggcaagaagggcgtgcaggaa
atcgtcatcggcatggcccaccgcggccgcctgaacgtgctcgtgaacacgctcggcaag
atgccggccgacctgttcgccgaattcgaaggcaagcacgtcgatgacctgccggccggc
gacgtgaagtaccacaagggcttctcgtcggacgtgtcgacggaaggcggcccggtccac
ctgtcgctcgcgttcaacccgtcgcacctcgaaatcgtgaacccggtggtcgaaggctcg
gcgaaggcgcggatggaccgtcgcggcgacgaagacggcctgcaggtgctgccggtgcag
atccacggcgacgcggccttcgccggccagggcgtcgtgatggaaacgctgaacctcgcg
cagacgcgcggctacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtccgacccgcgcgatgcgcgctcgacgctgtactgtaccgacgtcgtcaag
atgatcgaggcgccggtgctgcacgtgaacggcgacgatccggaagccgtgatcctcgcg
acgcagatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctgggtcacaacgagcaggacacgccggcggtcacgcagccgctgatg
tacaagaagatcgcgcagcacccgggcacccgtgcgctgtacgccgagaagctcgtgcag
cagggcgtgatcagcgcggaagacgccgacggcttcgtgaaggcgtaccgcaaggcgatg
gacgacggccaccacacggtcgatccggtcctgtcgaactacaagagcaagtacgcggtc
gactgggtgccgttcctgaatcgcaagtggacggacgcagccgacacggcggtgccgctc
gccgaactgaagcgcctcggcgaacgcatcacgacggtgccggaaaacttcaaggtccac
ccgctcgtcgagcgcgtgatcaacgaccgccgcaacatggcgcgcggcgaccagccgctc
gactggggcatggccgagcacctcgcgttcgcgtcgctcgtcgcgtcgggctacgcggtg
cgcctgaccggccaggactcgggccgcggcacgttcacgcaccgtcacgcggtgctgcac
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacgtcgccgac
aaccaggcgaagttcacggtgatcgactcggtgctgtcggaagaggcggtgctgggcttc
gaatacggctactcgaccgccgagccgaacacgctcgtgctgtgggaagcgcagttcggc
gacttcgtcaacggcgcgcaggtcgtgatcgaccagttcatctcgtccggcgaagtgaag
tggggccgcgtgtcgggcctgacgatgctgctgccgcacggctatgaaggccagggcccg
gagcactcgtcgacccgtatcgagcgtttcctgcaactgtgcgcggaccacaacatgcaa
gtggtccagccgacgacgccggcgcagatcttccacctgctgcgccgccagatgatccgc
ctgttccgcaagccgctgatcgtcgcgacgccgaagtcgctgctgcgtcacaaggaagcc
gtgtcggacctgtcggaactggcgaagggctcgttccagccggtgctcggcgaaaccgac
ggcggcatcgacgcgaagaaggtcaagcgcgtgctggtctgctcgggccgcgtgtacttc
gacctcgtcgcgcatcgccgcgaagcgaaggcgaacgacgttgcgatcatccgtatcgaa
caactgtatccgttcgcgcacaagcagttcgaagctgaactgaagaagtacgagaacgcg
accgaagtggtctgggtgcaggacgagccgcaaaaccagggcccgtggttctatgtcgaa
caccacctgaaggaaggcatgaaggaagggcagaagctggcatacagcggccgtccggct
tcggcctcgccggcggtcggctactacgcgaagcactacgagcagcagaaggccctcatc
gaaggtgctttcggccgcctgaagagcgcatcgatcgcgaaataa

DBGET integrated database retrieval system