KEGG   Burkholderia ubonensis: BW23_2636Help
Entry
BW23_2636         CDS       T03794                                 

Definition
(GenBank) putative gst-related protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bub  Burkholderia ubonensis
Pathway
bub00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BW23_2636
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bub02000]
    BW23_2636
Enzymes [BR:bub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BW23_2636
Transporters [BR:bub02000]
 Other Transporters
  Pores ion channels [TC:1]
   BW23_2636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: AJX16872
LinkDB All DBs
Position
I:2829426..2830082
Genome map
AA seq 218 aa AA seqDB search
MLQLCGIPLSNYYNKVKFVLLEYGIPFEEARCGLPISDPAVLADTPLGKIPFLKTEQGAL
FESQVIIEYLAARYPDKPIFPSDPFEAAKVRELVETLELYLEWTAREVYTEAFFGGKVSD
GMKAHVEKRLPRAIDAFKTMTRFSPYVLGDSFGLADIAASIHLPVIGMATKTVYGRDFLL
EAGIDWKAHAQKVGERPAAQRVAEDRKAYLAAANGKLP
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctacagctgtgcggtattccgttgtccaactactacaacaaggtgaagttcgtcctg
ctcgagtacggcattccgttcgaggaagcgcggtgcggcctgccgatcagcgatccggcc
gtgctcgccgatacgccgctcggcaagattccgttcctgaagaccgaacagggcgcgctg
ttcgaatcgcaggtgatcatcgaatatctggcggcgcgctatccggacaagccgattttt
ccgtccgacccgtttgaggcggcgaaggtgcgtgagctcgtcgagacgctcgagctgtat
ctcgaatggaccgcgcgcgaggtctatacggaagcgtttttcggcgggaaggtcagcgac
gggatgaaggcgcacgtcgagaagcgcctgccgcgcgcgatcgacgcgttcaagacaatg
acgcgcttctcgccctacgtgctcggcgattcgttcggcctcgcggacatcgccgcgtcg
atccacctgccggtgatcggcatggcgacgaagacggtctacggccgcgatttcctgctc
gaagcgggcatcgactggaaggcgcatgcgcagaaggtcggtgagcgcccggccgcgcaa
cgcgtcgccgaagatcgcaaggcgtatctcgcggcggcgaacggcaagcttccttga

DBGET integrated database retrieval system