KEGG   Burkholderia ubonensis: BW23_4104Help
Entry
BW23_4104         CDS       T03794                                 

Gene name
cga
Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
bub  Burkholderia ubonensis
Pathway
bub00500  Starch and sucrose metabolism
bub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BW23_4104 (cga)
Enzymes [BR:bub01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BW23_4104 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AJX14013
LinkDB All DBs
Position
II:complement(918706..920868)
Genome map
AA seq 720 aa AA seqDB search
MHSRHPVTASSAALGGAPSTQAHGVAPGAPGAAGGWNPANKHGFGTSTTLESKVWFTLGS
AGLDEIYYPRVDTPSVRDLRFVVSDGKTFAERVTDHATHETTLIDADGLTYRQVDVDDAG
RYRLTTTYVTDPARPVVLVDVTFESLDGRPYQVYALLNPAPGNALTNTTGETNGATLTAR
NGNVATAFASSPPFTRLSNGYAGASDGWQDIGRHFCITRAYACAPRGNVVQTGQTPLDGV
TRTHVTLAIGFGADTAQADSNAQCALADGFTSTAGRYAEGWHRYLQSLEPAPASAAGHFR
LYDAAVMILAAHEDKTWRGAFVASPSMPWACGAALDHPSGPYHLVWARDLYQIATALIAA
GDRRAAERALDWLFMTQQKADGAFPQNSQVDGTPYWRGLQMDEVSFPIVLAWQLQRFDEP
TYLNHIRKAADFIVATGPYTPAERWENQGGYSPAAIAAQIAGLVAAADIARRNGDAASAA
TYAATADAWQRNVESWTATCTGPYSRSPYYLRLTKDRRPDAATAYAISDGGPDGIDQRAV
VDPSFLDLVRLGVKPADDPVILNSLAVIDAQLGVATPNGMFWHRYTFDGYGERRDGGAWR
MDLPAGSRLTIGRAWPIFAGERGEYELAANRPDLARSRLDAMAASANDGLMLPEQVWDRQ
APSGQPGFAPGTGTTSATPLAWTAAQFVRLAWSIDCGAPVAMPSIVASRYAGRCKDDDED
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcattccaggcatcccgttaccgcgtcgtcggccgcacttggcggcgccccctccaca
caagcccacggcgtcgcgcccggcgcaccgggcgcggcaggcggctggaatccggcaaac
aagcacggcttcggcacctcgacgacgcttgaaagcaaggtctggttcacgctcggcagc
gccggcctcgacgagatctattacccgcgcgtcgacacgccgagcgtgcgcgacctgcgg
ttcgtggtctcggacggcaagaccttcgcggaacgcgtcaccgatcatgcgacgcacgag
acgacattgatcgacgcggacggcctcacctaccgtcaggtcgacgtcgacgacgccggc
cgctaccggctgacgacgacgtacgtaacggacccggcacgcccggtggtgctcgtcgac
gtcacgttcgaatcgctcgacggacggccctatcaggtctacgcgctgctgaaccccgca
cccggcaatgcgctgacgaacacgacgggcgagacgaacggcgcgacgctgaccgcgcgc
aacggcaacgtcgcgaccgcgttcgcgtcgagtccgccctttacccgcctgtcgaacggc
tatgccggcgccagcgacggctggcaggacatcggccggcacttttgcataacccgtgcc
tacgcgtgcgcgccgcgaggcaatgtcgtgcagaccggccagacgccgctcgacggcgtg
acgcgcacgcacgtcacgctcgcgatcgggttcggcgccgacaccgcgcaggcggacagc
aacgcgcaatgcgcactggccgacggttttacatcgacggccggccggtatgcggaaggc
tggcatcgctacctgcagtcgctcgagccggcgccggcgagcgcggccggccacttccgc
ctgtacgacgcggccgtgatgatcctcgccgcgcatgaggacaagacctggcgcggcgcg
ttcgtcgcttcgccgtcgatgccctgggcgtgtggcgcagcgctcgaccatccgtccggg
ccataccatctcgtctgggcgcgggacctctaccagattgcgaccgcgctgattgccgcg
ggcgaccgccgcgccgccgagcgcgcgctggactggctgttcatgacgcagcagaaagcc
gacggcgcgttcccgcagaattcgcaggtcgacggcacgccgtactggcgcgggctgcag
atggacgaagtgtcgtttccgatcgtgctggcctggcagttgcagcgcttcgacgagccg
acgtatctgaatcacatcaggaaggccgccgatttcatcgtcgcgacagggccgtacacg
ccggcggagcgctgggagaatcagggcggttactcgccggccgccatcgcggcccagatc
gccggcctcgtcgccgcggcggatatcgcgcgccgcaacggcgatgcggcgtcggccgca
acctatgcggccacggcggacgcgtggcaacgcaacgtggaatcatggacggcgacctgc
acgggcccgtactcgcgctcgccgtactacctgcggctgaccaaggaccggcgtcccgat
gccgccacggcgtacgccatcagcgacggcggtccggacggcatcgaccagcgcgcggtg
gtcgacccgagcttcctcgatctcgtcaggctgggcgtgaagccggctgacgatccggtg
atcctgaacagtctcgcggtgatcgacgcgcaactgggcgtggccacgccgaacggcatg
ttctggcatcgctacaccttcgacggctatggcgagcggcgcgacggcggcgcatggcgc
atggaccttccggccggcagtcgattgacgatcggccgcgcgtggccgatcttcgcgggc
gagcgcggcgagtacgagctggccgcgaaccggcccgatctcgcgcggtcgcgcctcgac
gcgatggcggcaagcgcgaacgacgggctgatgctgccggagcaggtctgggatcggcag
gcgccgtcggggcagccaggtttcgccccgggaaccggcacgacgtcggcgacgccgctc
gcgtggaccgctgcccagttcgtgcgccttgcgtggtcgatcgactgcggtgcgcccgtg
gcgatgccgtccatcgtcgcgagccggtatgccgggaggtgcaaggatgacgacgaggac
tga

DBGET integrated database retrieval system