KEGG   Burkholderia sp. Bp5365: AQ610_00740Help
Entry
AQ610_00740       CDS       T04266                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bud  Burkholderia sp. Bp5365
Pathway
bud00010  Glycolysis / Gluconeogenesis
bud00620  Pyruvate metabolism
bud01100  Metabolic pathways
bud01110  Biosynthesis of secondary metabolites
bud01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AQ610_00740
   00620 Pyruvate metabolism
    AQ610_00740
Enzymes [BR:bud01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AQ610_00740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALX44174
LinkDB All DBs
Position
1:complement(166997..168517)
Genome map
AA seq 506 aa AA seqDB search
MNHADMQHLNIEFPYRKQYGNFIGGEWVAPVGGEYFDNVSPVTGRPFTAIPRSRAADVEL
ALDAAHAAKAGWAATGAAERANVLLKIADRMEANLTRLAVAETIDNGKPLRETTAADVPL
AIDHFRYFAGCIRAQEGSIADIGDDMVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALA
AGNCVVLKPAEQTPASILVFAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTG
ETSTGRLIMQYASENLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYDRFIERALKRVEAIKQGHPLDAQTMIGAQASAEQLEKILSYIDIGR
GEGAQCLTGGERNVLGGELAEGYYVKPTVFRGHNKMRIFQEEIFGPVLAVTTFKTEEEAL
EIANDTLYGLGAGVWTRDGNRAYRVGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYGEKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcggacatgcaacatctgaacatcgaattcccgtaccgcaagcagtacggg
aatttcatcggcggcgaatgggtcgccccggtcggcggcgagtatttcgacaacgtctcg
cccgtcaccggccggccgttcaccgcgatccctcgctcgcgcgcagccgacgtcgagctc
gcgctcgacgccgcgcacgcggcgaaggcgggctgggccgcgacgggcgcggccgagcgc
gcgaacgtgctgctgaagatcgccgaccggatggaggcgaacctcacgcgccttgctgtc
gccgagacgatcgacaacggcaagccgctgcgcgagaccaccgcggccgacgtgccgctc
gcgatcgaccacttccgctacttcgcgggctgcatccgcgcgcaggaaggctcgatcgcc
gacatcggcgacgacatggtcgcctatcacttccacgagccgctcggcgtcgtcggccag
atcatcccgtggaacttcccgttgctgatggccgcgtggaagctcgcgcccgcgctcgcg
gccggcaactgcgtcgtgctcaaacccgccgagcagacgcccgcgtcgatcctcgtgttc
gccgagctgatccaggatctgctgccgcccggcgtgctcaacatcgtcaacggcttcggg
ctcgaggcgggcaagccgctcgcgtcgagcaagcggatcgcgaagatcgcgttcacgggc
gagacgtcgacgggccgcctcatcatgcagtacgcgagcgagaacctgatccccgtcacg
ctcgagctcggcggcaagagcccgaacatcttcttcgccgacgtgatggaccgcgacgac
agctacttcgacaaggcgctcgaaggcttcgcgatgttcgcgctgaaccagggcgaggtc
tgcacgtgcccatcgcgcgcgctcgtcgaggagagcatctacgatcgcttcatcgagcgt
gcgttgaagcgcgtcgaggcgatcaagcagggccatccgctcgacgcgcagacgatgatc
ggcgcgcaggcgtcggccgagcagctcgagaagatcctgtcgtacatcgacatcggccgc
ggcgaaggcgcgcagtgcctgacgggcggcgagcgcaacgtgctcggcggcgagctcgcc
gaaggctattacgtgaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaagagatcttcgggccggtgctcgcggtgacgacgttcaagaccgaggaggaagcgctc
gagatcgcgaacgacacgctgtacggcctcggcgcgggcgtctggacgcgcgacggcaac
cgcgcataccgcgtcggccgcggcatccaggcgggccgcgtgtggacgaactgctatcac
gcgtatccggcgcacgcggcgttcggcggctacaagcagtcgggcatcggccgcgagacg
cacaagatgatgctcgaccactaccagcagacgaaaaacctgctcgtcagctacggcgag
aagccgctcgggttcttctga

DBGET integrated database retrieval system