KEGG   Burkholderia sp. Bp5365: AQ610_07340Help
Entry
AQ610_07340       CDS       T04266                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bud  Burkholderia sp. Bp5365
Pathway
bud00480  Glutathione metabolism
bud00590  Arachidonic acid metabolism
bud01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bud00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AQ610_07340
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AQ610_07340
Enzymes [BR:bud01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AQ610_07340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ALX42252
LinkDB All DBs
Position
1:1597397..1597876
Genome map
AA seq 159 aa AA seqDB search
MSKLYSFNAQALSGGEVPLEQYRGKVLLIVNTASECGFTPQYAGLQQLYDRFRERGLVVL
GFPCNQFGKQEPGDASQIGAFCEKNYGVTFPMFAKIDVNGANAHPLYRYLTEEAPGILGL
KAIKWNFTKFLVNREGEIVKRYAPSTKPEDIAADVDKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaactgtattcattcaacgcgcaggcgctttcgggcggcgaggtgccgctcgag
cagtaccggggcaaggtgctcctcatcgtcaacacagcgagcgaatgcggattcacgccg
cagtacgcggggctgcagcagttgtacgaccgctttcgcgaacgcgggctcgtcgtgctc
ggctttccgtgcaatcagttcggcaagcaggagccaggcgacgcgtcgcagatcggcgcg
ttctgcgagaagaactacggcgtcacgtttccgatgttcgcgaagatcgacgtgaacggc
gcgaacgcgcaccctctgtaccggtatctgaccgaagaggcgcccggcattctcggcctc
aaggcgatcaagtggaatttcacgaagttcctcgtgaaccgggaaggcgagatcgtgaag
cgctacgcgccgtcgacgaagcccgaggatatcgctgcggacgtcgacaagctgctctaa

DBGET integrated database retrieval system