KEGG   Burkholderia sp. Bp5365: AQ610_20175
Entry
AQ610_20175       CDS       T04266                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bud  Burkholderia sp. Bp5365
Brite
KEGG Orthology (KO) [BR:bud00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bud02044]
    AQ610_20175
Secretion system [BR:bud02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AQ610_20175
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ALX44859
LinkDB
Position
2:complement(165464..166045)
AA seq 193 aa
MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKPVAPLPAVADR
RFLDIDIDNFDERMKAIKPRVAVAVDNTLSGDGQLMVDMTFESIEDFSPAAIARMVGPLR
QLLEARTQLANLQTYMDGKSGAETLVNRLLQDPALLQSLAAAPKPQLAGGSDAQDTHDAH
DAKDAAGRDSDAA
NT seq 582 nt   +upstreamnt  +downstreamnt
atgtccgcatccagcagctctcaaaaattcatcgcgcgcaatcgcgcgccccgcgtgcag
atcgagtacgacgtcgaagtctacggctcggaaaagaaggtcgaactgccgttcgtgatg
ggcgtgctcgccgacctgtcgggcaagccggtcgcgccgctgcccgccgtcgccgatcgg
cgcttcctcgacatcgacatcgacaacttcgacgagcggatgaaggcgatcaagccgcgc
gtcgcagtcgcggtcgacaacacgctgtcgggcgacgggcaactgatggtcgacatgacg
ttcgaaagtatcgaggacttctctcccgccgcgatcgcgcggatggtcgggccgttgcgc
cagttgctcgaggcgcgcacgcagctcgcgaacctgcagacctacatggacggcaagtcg
ggcgccgagacgctcgtcaaccggttgctgcaggacccggcgctgctccagtcgctcgcg
gccgcgccgaagccgcagctcgctggtggctccgacgcacaggacacgcacgacgcgcac
gacgcgaaggacgcggcgggccgcgacagcgacgcggcctga

DBGET integrated database retrieval system