KEGG   Burkholderia sp. Bp5365: AQ610_21045Help
Entry
AQ610_21045       CDS       T04266                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bud  Burkholderia sp. Bp5365
Pathway
bud00250  Alanine, aspartate and glutamate metabolism
bud00410  beta-Alanine metabolism
bud00640  Propanoate metabolism
bud00650  Butanoate metabolism
bud01100  Metabolic pathways
bud01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AQ610_21045
   00650 Butanoate metabolism
    AQ610_21045
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AQ610_21045
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AQ610_21045
Enzymes [BR:bud01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AQ610_21045
Amino acid related enzymes [BR:bud01007]
 Aminotransferase (transaminase)
  Class III
   AQ610_21045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALX45016
LinkDB All DBs
Position
2:complement(394965..396248)
Genome map
AA seq 427 aa AA seqDB search
MNNADLHARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAIAGQLEQFTHTAYQIVPYASYVELAEKINARAPIAQPKKTAFFTTGAEAVENAVKI
ARAYTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKIGFGPFPGDVFHAPYPNALRGVSSA
DSIAAVETLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVCALRKLCDAHGILLIADEV
QTGFARTGKLFAMEHYDARADLMTIAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDVIDEEKLAERANALGDKLKAKLAALRADVPQIADVRGPGAMVAAEFVD
PDTRASDAAFTKRVQTLALERGLLLLICGVDANVIRFLFPLTIQDAVFDEALGILESVLK
EAVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatgccgatctgcacgcccgcaagaacgccgcgacgccgcgtggcgtcggcgtg
atgtgcgatttctacgccgcgcgcgccgagaacgccgagctgtgggacgtcgagggccgc
cgcttcatcgatttcgcggccggcatcgcggtcctgaacacgggccatcgccatccgaag
atcgtgaaggcgatcgccgggcagctcgagcagttcacgcacaccgcctatcagatcgtg
ccttacgcgtcgtacgtcgagctcgccgagaagatcaacgcgcgcgcgccgatcgcgcag
ccgaagaagaccgcgttcttcacgacgggcgcggaagccgtcgagaacgcggtgaagatc
gcgcgcgcctacaccggccggccgggcgtgatcgcgttcgcgggcggcttccacggccgc
acgatgatgggcatggcgctcacgggcaaggtcgcgccgtacaagatcggcttcggcccg
ttcccgggcgacgtgttccacgcgccgtatccgaacgcgctgcgcggcgtgtcgagcgcc
gattcgatcgccgccgtcgagacgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgattatcttcgagccggtgcagggcgaaggcggcttcaacccggcgcccgccgagttc
gtctgcgcgctgcgcaagctgtgcgacgcgcacggcatcctcctcatcgccgacgaagtg
cagacgggctttgcgcgcacgggcaagctgttcgcgatggagcactacgacgcgcgcgcc
gatctgatgacgatcgcgaagagcctcgcgggcgggatgccgctgtcgggcgtcgtcggc
cgcgcggacgtgatggacgcggccgcgccgggcggcctgggcggcacgtacgcgggcaat
ccgctcgccgtcgccgccgcgcacgcggtgctcgacgtgatcgacgaggagaagctcgcc
gagcgcgcgaacgcgctcggcgacaagctcaaggcgaagctcgcggcattgcgcgccgac
gtgccgcagatcgccgacgtgcgcggcccgggcgcgatggtcgccgcggaattcgtcgat
ccggacacgcgcgcgtccgacgccgcgttcacgaagcgcgtgcagacgctcgcgctcgaa
cgcgggctgctgctgctcatctgcggcgtcgacgcgaacgtgatacggttcctctttcct
ctcaccatccaggatgccgtgttcgacgaagcgctcggcattctcgagagcgtgctgaag
gaagcggtgggcgtgcccgcctga

DBGET integrated database retrieval system