KEGG   Burkholderia sp. Bp5365: AQ610_21760Help
Entry
AQ610_21760       CDS       T04266                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bud  Burkholderia sp. Bp5365
Brite
KEGG Orthology (KO) [BR:bud00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AQ610_21760
Enzymes [BR:bud01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AQ610_21760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 Glutaredoxin FAD_oxidored DAO Thi4 HI0933_like FAD_binding_3 NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ALX45138
LinkDB All DBs
Position
2:complement(553823..555430)
Genome map
AA seq 535 aa AA seqDB search
MLDANLKTQLKSYLERITRPVELVASLDDGGQSRELRALLDEIASLSPQVSIVERRDGAE
RTPSFSVGEPGKAAGIRFAGMPMGHEFTSLVLALLQTGGHPIKLDDATIEQIRALDGDYA
FETYISLTCQNCPEVVQALNVMALVNPRIRHVMIDGALFQDEVEARRIMAVPTIFLNGET
FGQGRSSVKEILAKLDRGASRRAAQALAEKPVFDMLIVGGGPAGAAAAIYAARKGISTGV
VAERFGGQVLDTMAIENFVSVKETEGPKFATALEQHVKQYEVDVIDVQRADRLVPGRIHE
IRLASGAVLKAKAVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVSEVTLIEYGAQLRADDVLQRKLHSLANVTVLTRARTTELTGDGARL
NGLVYEDMRTGEAKRIALEGVFVQIGLVPNAEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPYKQIVIAVGEGAKASLGAFDYLIRSEADAAQAADAEASASAEMIAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatctcaagactcagttgaaatcgtacctcgaacggatcacgcgtccc
gtcgagctcgtcgcatcgctcgacgacggcggccagtcgcgcgagctgcgcgcgctgctc
gacgagatcgcgtcgctttcgccgcaagtctcgatcgtcgagcgccgcgacggggcggag
cgcacgccgtcgttctcggtcggcgagccgggcaaggccgcgggcatccgcttcgccggg
atgccgatgggccatgagttcacgtcgctcgtgctcgcgctgctgcagacgggcggccat
ccgatcaagctcgacgacgcgacgatcgagcagatccgcgcgctcgacggcgattacgcg
ttcgagacgtacatctcgctcacctgccagaactgcccggaagtcgtgcaggcgctcaac
gtgatggcgctcgtcaacccgcgcatccgccacgtgatgatcgacggcgcgctgttccag
gacgaagtcgaggcgcgccggatcatggccgtgccgacgatcttcctgaacggcgagacg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgaccgcggcgcgagc
cggcgcgcggcgcaggcgctcgcggaaaagcccgtgttcgacatgctgatcgtcggcggc
ggccccgccggcgcggcggccgcgatctacgcggcgcgcaagggcatctcgacgggcgtc
gtcgccgagcgcttcggcgggcaagtgctcgacacgatggcgatcgagaacttcgtgtcg
gtcaaggaaaccgaagggccgaagtttgcgaccgcgctcgagcagcacgtgaagcaatac
gaagtcgacgtgatcgacgtgcagcgcgccgaccggctcgtgccgggccgcatccacgaa
atccgcctcgcgagcggcgcggtgctgaaggcgaaagccgtcgtgctcgccacaggcgcg
cgctggcgcgaaatcggcgtgcccggcgagcgcgagtatcgcaaccgcggcgtcgcgtac
tgcccgcattgcgacggcccgcttttcaagggcaagcgcgtcgcggtggtcggcggcggc
aattcgggcgtcgaggccgcgatcgatctcgccggcatcgtgagcgaagtgacgctgatc
gaatacggcgcgcaactgcgcgcggacgacgtgctgcagcgcaagctgcacagcctcgcg
aacgtgacggtgctcacgcgtgcccgcacgaccgaactcacgggcgacggcgcgcggctg
aacgggctcgtctacgaggacatgcgcaccggcgaagcgaagcgcatcgcgctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacgccgaatggctgaagggaacggtcgagctg
tcgaagcacggcgagatcgtcgtcgacgcgcgcggcgcgacgtcggtgcccggcgtgttc
gccgccggcgacgtgacgaccgtgccgtacaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcatcgctcggcgcgttcgactatctgattcgaagcgaagcggatgcggcgcag
gcggcggatgccgaagcctcggcgagcgccgagatgatcgccgcctga

DBGET integrated database retrieval system