Burkholderia humptydooensis MSMB43: AQ610_23210 Help Entry AQ610_23210       CDS       T04266                                  Name (GenBank) BapB protein   KO K02078   acyl carrier protein Organism bud  Burkholderia humptydooensis MSMB43 Pathway bud00998   Biosynthesis of various antibiotics bud01100   Metabolic pathways bud01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bud00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AQ610_23210   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AQ610_23210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF883_C Motif Other DBs NCBI-ProteinID:  ALX45383 UniProt:  A0A7U4SV10 LinkDB All DBs Position 2:937730..938011 Genome browser AA seq 93 aa AA seqDB search MTAGSRPNDAAALAAAAALLAGMLGVPEARIAPEQRLLDDLAMDSLELIELAMELDERWN IRLDRARLADVATVADVAALLGAAAQPDGASRT NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgacggccggctcgcgcccgaacgacgccgccgcgctcgcggcggcggcggcgctgctg gccggcatgctgggcgtgccggaagcgcggatagcgccggagcagcggctgctcgacgat ctggcgatggattcgctcgaattgatcgaactcgcgatggagctcgacgagcgctggaac atccggctcgatcgcgcgcggcttgccgacgtcgcgacggttgccgacgtcgccgcactg ctcggcgcggccgcgcagccggacggcgcgagccggacatga

DBGET integrated database retrieval system