KEGG   Burkholderia sp. Bp5365: AQ610_28100Help
Entry
AQ610_28100       CDS       T04266                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bud  Burkholderia sp. Bp5365
Pathway
bud00440  Phosphonate and phosphinate metabolism
bud01100  Metabolic pathways
bud01120  Microbial metabolism in diverse environments
bud01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bud00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    AQ610_28100
Enzymes [BR:bud01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     AQ610_28100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD L27
Motif
Other DBs
NCBI-ProteinID: ALX46243
LinkDB All DBs
Position
2:2065202..2066890
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLTSPSLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAQAGADAILIHSKLSRPDEILQFAREWSGRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIQDSETLVNVEERVASVNEIFRLQDADEYSAAERIYLSSS
ARASSAALVLAASRGKGLEAVTEDKPKVMLPIAGKPLLRWLVDGFKKQGVNDITVVGGYR
ADAIDTSGVKLVVNERHAQTGELASLACAAERMTGDTIVSYGDLLFRSYILRDLAESEAE
FSVVVDSSQTQPSNQSVRDFAFCSAADDRGLFGQKALLRRVSSDASEAGPHGRWIGLLNV
RGAGVARLKAMLDTLKARDDFDALDLPALLNALIDAGEQIEVQYVHGHWRGVNDLDDFRR
AGDFAHGQTPYAEQNAGNGDAR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaaccgaacttcaccgaatcgcgcagcgcgcggctgcggcggatgctg
acgagcccgtcgctcgaattcctgatggaggcgcacaacggcctgtccgcgcggatcgtc
cgcgaggcgggcttcaagggcatctgggcgtcggggctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaagcgagctggacacaggtcgtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgataccggctacggcaacttcaacaac
gtgcgccggctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagttcccgaagaccaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggatttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgcgcaggccggcgccgatgcgatcctgatccacagcaagctgtcgcgc
cccgacgagatcctgcagttcgcgcgcgaatggagcggccgcgcgccgctcgtgatcgtg
ccgaccaagtattacagcacgccgaccgatgtgttccgccaggcgggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcgtcggcgtccgcgatgcaggcggtcgcgcgcgaa
atccaggacagcgaaacgctcgtcaacgtcgaggagcgcgtcgcgagcgtcaacgagatc
ttccggctgcaggacgccgacgaatactcggccgccgagcggatctatctgtcgtcgagc
gcgcgcgcgtcgagtgcggcgctcgtgctcgcggcgagccgcggcaaggggctcgaggcc
gtcaccgaggacaagccgaaggtgatgctgccgatcgccggcaagccgctgttgcgctgg
ctcgtcgacggcttcaagaagcagggcgtgaacgacatcacggtcgtcggcggctatcgc
gccgatgcgatcgacacgtccggcgtgaagctcgtcgtcaacgagcggcatgcgcaaacg
ggcgagctcgcgtcgctcgcgtgcgcggccgagcgcatgacgggcgacaccatcgtctcg
tacggcgatctgctgttccgcagctacatcctgcgcgacctcgcggagagcgaggcggag
ttcagcgtcgtcgtcgactcgtcgcagacgcagccgtcgaaccagagcgtgcgcgacttc
gcgttctgctcggccgccgacgaccgcgggctgttcggccagaaggcgcttctgcgccgc
gtgtcgagcgacgcgagcgaggccgggccgcacggccgctggatcggcctgctgaacgtg
cgcggcgcgggcgtcgcgcggctgaaggcgatgctcgacacgctgaaggcgcgcgacgat
ttcgatgcgctcgatctgccggcgctcctgaacgcgctcatcgacgcgggcgagcagatc
gaggtgcagtacgtgcacggccattggcgcggcgtcaacgatctcgacgacttccgccgc
gcgggcgatttcgcgcacggccagacgccgtatgcggagcagaacgcgggcaacggggac
gcgcgatga

DBGET integrated database retrieval system