KEGG   Burkholderia sp. RPE67: BRPE67_ACDS06170Help
Entry
BRPE67_ACDS06170  CDS       T03604                                 

Definition
(GenBank) glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bue00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BRPE67_ACDS06170
Enzymes [BR:bue01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BRPE67_ACDS06170
Transporters [BR:bue02000]
 Other Transporters
  Pores ion channels [TC:1]
   BRPE67_ACDS06170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_C GST_C_2 GST_N_3 GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: BAO85672
UniProt: A0A060NV61
LinkDB All DBs
Position
1:complement(673627..674232)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKAGACSLASHIALEESGLPYEIEAVDLKTKLTASGADFTQINAKGYVPALLLDNG
ELLTEGPAIMQYVADQVPAKHLAPLNDGMARYRLQSWLTFIGTELHKNFSPFFNPAASSD
WKAAAMANLERRLGYVAQQVDDKQFLLGNEFSIGDAYLFTVLGWAKHIDLDLGKWPALVA
YQERVGARHGVQAAMKAEGLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactgttctacaaagcaggcgcctgttcccttgcatcgcatatcgcgctcgaagaa
tcaggattgccttacgaaatcgaagccgtcgatctcaagaccaagctcaccgcgagcggc
gcggatttcacccagatcaacgcaaagggctacgtgcccgccctcctgctcgacaacggc
gaattgctgaccgaaggcccggcgatcatgcagtatgtcgctgaccaagttccggcgaag
catctcgcgccgctcaacgacggcatggcgcgttatcgcctgcaaagctggctcacgttc
atcggcacggagctgcacaagaacttctcgccgttcttcaacccggctgcgagcagcgac
tggaaagccgcggccatggcgaatctcgagcgccgtctcggctatgtcgcgcaacaggtc
gacgacaagcagttcctgctcggcaacgaattcagcatcggcgatgcgtatctcttcacc
gtgctcggctgggcgaagcacatcgatctcgatctcggcaagtggccggcgctcgtcgcg
tatcaggaacgtgtcggcgcgcgtcacggcgtgcaggcggcaatgaaggccgaaggcttg
ctgtaa

DBGET integrated database retrieval system