KEGG   Burkholderia sp. RPE67: BRPE67_ACDS06750Help
Entry
BRPE67_ACDS06750  CDS       T03604                                 

Definition
(GenBank) 2,3-dimethylmalate lyase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00440  Phosphonate and phosphinate metabolism
bue01100  Metabolic pathways
bue01120  Microbial metabolism in diverse environments
bue01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bue00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BRPE67_ACDS06750
Enzymes [BR:bue01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BRPE67_ACDS06750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL NTP_transferase IspD
Motif
Other DBs
NCBI-ProteinID: BAO85730
UniProt: A0A060NWM3
LinkDB All DBs
Position
1:737592..739289
Genome map
AA seq 565 aa AA seqDB search
MNALTQIPVGYSRTMRLREMLQSNRLEFLMEAHNGISARIAKEAGFKAIWGSGLSISAQF
GVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADIDEFCGKIKAGKDSQSDPNFSIVARVEALIAGWGMEEALK
RAEAYRQAGADAILIHSKLSKPDEILTFAREWAGRGPLVIVPTKYYSTPTDAFRQAGISC
VIWANHLIRGAVSAMQAIAKEIHDSETLVNVEDRIAAVNEIFRLQDADEYSAAENIYLTA
ANEKRSAIVLAASRGAGLEALTEARPKVMLPVAGKPLLRHLVEAFKKESINDITVVGGYR
ADAIESGGIRLVVNERHETTGELASLACAAKHMNGDTVISYGDLLFRSYILRDLTESDSD
FCVVVDSSQAPQAGDTVTDFAYCSTGDDRALFGQKVWLESVVGAGQSLIENRAPQGRWMG
LIKVRGGARERLLATLGTLQQRADFDQLDMAALLNALIAAGQKIEVQYVHGHWRGVNDLD
DFRRAGDFAHGQTPIGSEGAENARD
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcactcacacaaatcccggtcggctactcgcgcacgatgcgcctgcgcgaaatg
ctgcaaagcaatcgcctcgaattcctgatggaagcgcacaacggcatctccgcgcgcatc
gcgaaggaagcgggcttcaaggcgatctggggctcgggcctgtcgatttccgcgcaattc
ggcgtgcgcgacaacaacgaggcaagctggacgcaagtcgtcgacaacctcgaattcatg
gcggacgcgagcgatctgccgattctcctcgacggcgacaccggctacggcaacttcaac
aacgtgcgccggctcgtgaagaagctggaacagcgcggcatcgcgggcgtgtgcatcgaa
gacaagcagtttccgaagaccaacagcttcatcaacggcgaggcgcagccgctcgcggac
atcgacgaattctgcggcaagatcaaggccggcaaggattcgcagagcgatccgaatttc
tcgatcgtcgcgcgcgtcgaggcgctgatcgcgggctggggcatggaagaagcgttgaag
cgcgccgaggcgtaccgtcaggcgggcgcggacgcgatcctgattcattcgaagctctcg
aagccggacgaaatcctcacgttcgcgcgtgaatgggccgggcgcggcccgctcgtcatc
gtgccgacgaagtactacagcacgccgaccgacgcgttccgtcaggcgggcatcagttgc
gtgatctgggcgaaccatctgattcgcggcgcggtctcggcgatgcaggcgatcgcgaag
gaaatccacgacagcgagacgctcgtcaacgtggaagaccgcatcgcggcggtcaacgag
attttccgtttgcaggacgcggacgaatactcggccgccgagaacatctatctgacggcg
gcgaatgaaaagcgcagcgcgatcgtgctggccgcgagccgcggcgcgggcctcgaagcg
ctgaccgaagcgcgtccgaaggtcatgctgccggtcgcgggcaagccgcttttgcgccat
ctcgtcgaggcgttcaagaaggaaagcatcaacgacatcacggtcgtcggcggatatcgc
gcggacgcgatcgagtcgggcggcatccgtctcgtcgtcaacgaacggcatgaaacgacg
ggcgagctcgcctcgctcgcctgcgccgcgaagcacatgaacggcgacaccgtgatttcc
tacggcgatctgctgttccgcagctacatcctgcgcgatctgacggaatcggacagcgat
ttctgcgtggtcgtggattcgtcgcaggcgccgcaggcgggcgacaccgtcaccgacttc
gcgtactgctcgaccggcgacgaccgcgcgctcttcggccagaaagtgtggctcgaaagc
gtggtcggcgcggggcagtcgctgatcgaaaatcgcgcgccgcagggccgctggatgggt
ctcatcaaggtgcgcggcggcgcgcgcgagcgtttgctcgcgacgctcggcacgctgcag
cagcgcgccgacttcgaccagctcgacatggccgcgctcctgaacgcgctgatcgccgcc
ggccagaagatcgaagtgcagtacgtgcacggccactggcgcggcgtgaacgatctcgac
gatttccgtcgcgcgggcgatttcgcgcacggccagacgccgatcggctccgaaggcgcg
gagaacgcgcgtgattga

DBGET integrated database retrieval system