KEGG   Burkholderia sp. RPE67: BRPE67_ACDS23630Help
Entry
BRPE67_ACDS23630  CDS       T03604                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00473  D-Alanine metabolism
bue00550  Peptidoglycan biosynthesis
bue01100  Metabolic pathways
bue01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bue00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BRPE67_ACDS23630 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BRPE67_ACDS23630 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BRPE67_ACDS23630 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bue01011]
    BRPE67_ACDS23630 (ddl)
Enzymes [BR:bue01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BRPE67_ACDS23630 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bue01011]
 Precursor biosynthesis
  Amino acid ligase
   BRPE67_ACDS23630 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST CPSase_L_D2 TTL ATP-grasp ATP-grasp_4 ATPgrasp_YheCD BMC ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: BAO87418
UniProt: A0A060P6P0
LinkDB All DBs
Position
1:complement(2558531..2559484)
Genome map
AA seq 317 aa AA seqDB search
MSNQVNQIDPAVFGKVAVLLGGNSAEREVSLNSGRLVLEGLREAGIDAHAFDPARRPLSD
LKAEGFVRAFIALHGGYGENGQLQGALDFYGIRYTGSGVLGSALGMDKLRTKLVWQQTGI
PTPPFETVFRGEDYAARAQDIVAKLGLPLFVKPASEGSSVAVIKVKSAETLVPALEEAVK
YDKIVIVEKSIEGGGEYTCCIAGDLDLPVIKIVPAGEFYDYHAKYVANDTQYLIPCGLTD
AEETRMKALTKRSFEILGCTDWGRADFMLDANGNPYFLEVNTAPGMTDHSLPPKAARAVG
ISYKDLVVKVLSLTLKN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccaagtgaatcaaatcgatccggccgtattcggcaaagtcgcggtgctgctg
ggcgggaattccgccgagcgcgaggtctcgctcaattcggggcgtctcgtgctcgaaggc
ctgcgcgaagcaggtatcgacgcgcacgcgttcgatccggcgcggcgtccgctttcggat
ctgaaggccgaaggcttcgtgcgcgcgttcatcgcgctgcatggcggctatggcgagaac
ggccagttgcaaggcgcgctcgacttctacggcatccgttacacgggcagcggcgtgctc
ggttcggcgctcggcatggacaagctgcgcacgaagctcgtgtggcagcagaccggcatc
cccacgccgccgttcgaaaccgtcttccgcggcgaagactacgcggcgcgcgcgcaggac
atcgtcgcgaagctggggctgccgctcttcgtgaagccggcgagcgaagggtcgagcgtc
gcggtcatcaaggtgaagagcgcggaaacgctcgtgccggcgctcgaagaagcagtcaag
tacgacaagatcgtgatcgtcgagaagagcatcgaaggcggcggcgagtacacgtgctgc
atcgcgggcgatctcgacttgccggtcatcaagatcgtgccggcgggcgagttctacgac
tatcacgcgaagtacgtcgccaacgacacgcaatacctgattccgtgcggtctcacagac
gccgaagaaacgcgcatgaaggcgctgaccaagcgctccttcgagattctcggctgcacc
gactggggccgcgccgacttcatgctcgatgcaaacggcaacccgtacttcctcgaagtg
aacacggcgcccggcatgacggaccactcgctgccaccgaaggccgcgcgcgcggtcggt
atcagctacaaggatctcgtcgtgaaagtgctctcgctcacgctgaagaattag

DBGET integrated database retrieval system