KEGG   Burkholderia sp. RPE67: BRPE67_BCDS01280Help
Entry
BRPE67_BCDS01280  CDS       T03604                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00630  Glyoxylate and dicarboxylate metabolism
bue00710  Carbon fixation in photosynthetic organisms
bue01100  Metabolic pathways
bue01120  Microbial metabolism in diverse environments
bue01200  Carbon metabolism
Module
bue_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bue00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BRPE67_BCDS01280
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BRPE67_BCDS01280
Enzymes [BR:bue01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BRPE67_BCDS01280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAO88042
UniProt: A0A060P1Z3
LinkDB All DBs
Position
2:135333..135749
Genome map
AA seq 138 aa AA seqDB search
MHITQGTFSFLPQLTDEEISSQINYALDQGWSCSVEYTDDPHPRNTYWEMWGLPMFDLHD
AAGVLMEVNECRKTYPNHYIKVNAFDSVRGFETMRLSFMVNRPQEERGFRLERQDNRSRI
QRYAIRTYATDRPSGERY
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcacataacccaaggaaccttctccttcctcccacaattaaccgacgaagagatatcg
tcacaaatcaactacgccttagaccaaggctggtcctgctcagtcgaatacaccgacgat
ccccacccaagaaatacttattgggaaatgtggggcctccccatgttcgacctccacgat
gccgccggcgtgctgatggaagtgaacgaatgccgcaagacgtatccgaaccactacatc
aaggtcaacgccttcgattcagtacgtggcttcgaaacgatgcgtctctcgttcatggtt
aaccggccgcaagaagagcgaggcttccgcctcgaacgccaggacaacagaagccgcatc
cagcgctacgcgatccgcacctacgcaaccgatcgcccgagcggcgagcgctattga

DBGET integrated database retrieval system