KEGG   Burkholderia sp. RPE67: BRPE67_BCDS05680Help
Entry
BRPE67_BCDS05680  CDS       T03604                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bue  Burkholderia sp. RPE67
Brite
KEGG Orthology (KO) [BR:bue00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BRPE67_BCDS05680
Enzymes [BR:bue01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BRPE67_BCDS05680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 FAD_binding_3 Thi4 Glutaredoxin HI0933_like AlaDh_PNT_C DAO K_oxygenase FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAO88482
LinkDB All DBs
Position
2:complement(649010..650596)
Genome map
AA seq 528 aa AA seqDB search
MLDANLKNQLKAYLEKVTRPIELVAFLDGGDKSRELKSLLDEIASLSTRISVVEKEDASV
RRPSFTIGEPGKPAGIHFAGIPMGHEFTSLVLALLQTGGHPVKLDDATIEQIKNLDGDFA
FETYFSLSCQNCPEVVQALNVMSIINPRIKHVAIDGALFQQEVEAREVMSVPMMFVNGES
FGSGRMGVKEILAKLDTGASARAAKELENKPVFDVLIVGGGPAGAAAAIYAARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKSYEVDVMDVQRADKLVPGRVNE
IHLASGAVLKAKTVILSTGARWREINVPGEREYRGRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGLVSAVTLIEFGTELRADAVLQKKLRSLKNVTIVTNAQTTEISGDGKKV
SGITYTDRATGASHHVELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDAKGATSLPGVF
AAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRASVEDEAVVEEEAAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaatcagttaaaagcgtatttggaaaaagtcacccggccg
atcgaactcgtcgccttcctcgacggcggcgacaagtcgcgcgagctgaaaagcctgctc
gacgaaatcgcctcgctgtccacgcggatcagcgtcgtcgagaaagaggacgccagcgtg
cgtcgtccgtccttcaccatcggcgagccgggcaagcccgcgggcattcatttcgccggc
atcccgatgggtcatgaattcacgtcgctcgtgctcgccttgctgcagacgggcggccat
ccggtcaagctcgacgacgccaccatcgagcagatcaagaatctcgacggcgacttcgcg
ttcgagacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgatcatcaatccgcgcatcaagcacgtcgcgatcgacggcgcgctcttccag
caggaagtcgaagcgcgtgaggtcatgtccgtgccgatgatgttcgtcaacggcgagagc
ttcggctcgggccgcatgggcgtgaaggaaattctcgcgaagctggacacgggcgcctcg
gcgcgcgccgcgaaggaactggaaaacaagccggtgttcgacgtgctgatcgtcggcggc
ggtccggcgggcgcggcggcggcgatctacgcggcgcgcaagggcatcgccacgggcgtc
gtcgcggagcgcttcggcggccaggtgctcgacacgatggccatcgaaaacttcgtctcc
gtgcaggaaaccgaaggaccgaagttcgcgaccgcgctggagcagcacgtcaagagctat
gaagtcgacgtgatggacgtgcagcgtgccgacaagctcgtgccgggccgcgtgaacgag
attcatctcgcgagcggcgcggtgctgaaagcgaagaccgtgattctctcgaccggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgagtatcgcggccgcggcgtggcgtac
tgcccgcattgtgacggcccgctcttcaagggcaagcgcgtcgcggtggtcggcggcggc
aattcgggcgtggaagcggcgatcgacctcgcgggcctcgtgtcggcggtcacgctgatc
gagttcggcacggaactgcgcgccgacgcggtgctgcaaaagaagctgcgcagcctcaag
aacgtgacgatcgtcacgaacgcgcagaccacggaaatttccggcgacggcaaaaaggtt
agcggcatcacctacacggaccgcgcgacgggcgcatcacatcacgtcgaactggaaggc
gtgttcgtgcagatcggtctcgtgccgaacaccgaatggctcaaaggcacggtggaactg
tcgaagcacggcgagatcgtcgtcgatgcgaagggcgcgacctcgctgccgggcgtgttc
gccgcgggcgacgtgaccacggtgccgttcaagcagatcgtgatcgcggtaggcgaaggc
gcgaaggcatcgctgtcggcgttcgatcatctgatccgcgcgtcggtggaagacgaagca
gtggtcgaagaagaagcggcggcctga

DBGET integrated database retrieval system