KEGG   Burkholderia sp. RPE67: BRPE67_BCDS11590Help
Entry
BRPE67_BCDS11590  CDS       T03604                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bue00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BRPE67_BCDS11590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bue02000]
    BRPE67_BCDS11590
Enzymes [BR:bue01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BRPE67_BCDS11590
Transporters [BR:bue02000]
 Other Transporters
  Pores ion channels [TC:1]
   BRPE67_BCDS11590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: BAO89073
UniProt: A0A060PBA0
LinkDB All DBs
Position
2:complement(1206072..1206743)
Genome map
AA seq 223 aa AA seqDB search
MLTVHHLNNSRSQRVLWMLEELGVEYELKRYQRDPRTMLAPPELRAVHPLGKSPVVTDGD
LTLAESGAIIDYLVERYGDGRFSPPPGTSAERVRYNYWMHYAEGSAMPPLLLKLVARRLE
SAKMPFFARPIARRIAQTMQSSFIDPQLRLHFGYIEAELAKSTWFAGETFSAADVQMSFP
LETGGQRAGAKSMPHIRAFLERIHARPAYQRALERGGRYDFAT
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtccaccacctcaacaactcccgctcccagcgcgtgctctggatgctcgaa
gagctcggcgtcgaatacgagctaaagcgctatcagcgcgatccgcgcaccatgctcgcg
ccgcccgaactgcgcgcggtgcatccgctgggcaaatcgccggtcgtcaccgacggcgat
ctcacgctcgcggagtcgggcgcgatcatcgactatctggtcgagcgttatggcgatggg
cgcttctcgccgccgccgggcacgtcggccgaacgcgtgcgctacaactactggatgcat
tacgcggaaggctcggccatgccgccgctcttgctcaagctcgtcgcgcgccggctggaa
agcgcgaagatgccgttcttcgccaggccgatcgcgcggcgcatcgcgcagacgatgcaa
agcagtttcatcgatccgcaattgcggctgcacttcgggtatatcgaagcggagcttgcg
aaatcgacatggttcgcgggcgaaaccttcagcgccgccgacgtccagatgagctttccg
ctcgaaaccggcggccagcgcgccggtgcgaaatcgatgccgcatatccgcgcgtttctc
gaacgcattcacgcgcggcccgcgtaccagcgtgcgctcgagcgcggcgggcgctacgac
ttcgccacctga

DBGET integrated database retrieval system