KEGG   Burkholderia sp. RPE67: BRPE67_BCDS14110Help
Entry
BRPE67_BCDS14110  CDS       T03604                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00250  Alanine, aspartate and glutamate metabolism
bue00410  beta-Alanine metabolism
bue00640  Propanoate metabolism
bue00650  Butanoate metabolism
bue01100  Metabolic pathways
bue01120  Microbial metabolism in diverse environments
Module
bue_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bue00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BRPE67_BCDS14110
   00650 Butanoate metabolism
    BRPE67_BCDS14110
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BRPE67_BCDS14110
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BRPE67_BCDS14110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bue01007]
    BRPE67_BCDS14110
Enzymes [BR:bue01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BRPE67_BCDS14110
Amino acid related enzymes [BR:bue01007]
 Aminotransferase (transaminase)
  Class III
   BRPE67_BCDS14110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 TERF2_RBM
Motif
Other DBs
NCBI-ProteinID: BAO89325
UniProt: A0A060P6Y0
LinkDB All DBs
Position
2:1474694..1475989
Genome map
AA seq 431 aa AA seqDB search
MTSNLKNAALQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVCNTGH
RHPKIVEAIRAQLDCFTHTAYQIVPYESYVSLAEKISARAPATYPNKTAFFTTGAEAVEN
AVKIARVATGRPGVIAFTGGFHGRTLMGMALTGKVMPYKIGFGPFPSDVFHAPFPNELHG
VSVDDSLRALEHLFKADIDPTRVAAIIFEPVQGEGGFNPAPVEFVRGLRRICDELGILLI
ADEVQTGFARTGKLFAMEHYDVVPDLMTIAKSLAGGMPLSGVVGRADIMDAAAPGGLGGT
YAGNPLAVAAAHAVLDIIDEEALCERAVVLGDKLKAKLESLRRDVPQIADVRGPGAMIAV
EFCTPGSNDADAAFAKLVQTRALERGLLLLVCGVYSNVVRFLFPLTIQDQVFDEALGILE
EVLMESVGVAV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcaatctgaagaatgccgccctgcaagcccgcaagaatgccgcgacgccgcgc
ggcgtcggcgtgatgtgcgatttctacgcggcgcgggccgagaacgcggaactgtgggac
gtcgagggccggcgcttcatcgatttcgcggcgggcatcgcggtatgcaacacggggcat
cgccatccgaagatcgtcgaggcgatccgcgcgcagctcgactgcttcacccacaccgcg
tatcagatcgtgccgtacgaatcgtatgtgtcgctcgcggaaaagatctccgcgcgcgcg
ccggccacgtatccgaacaagaccgcgtttttcacgaccggcgcggaagccgtcgagaac
gcggtgaagatcgcgcgagtcgcaacgggccgtccgggcgtgattgccttcacgggcggc
tttcacggccgcacgctgatgggcatggcgctgaccggcaaggtcatgccgtacaagatc
ggcttcgggccgttcccgtcggacgtgtttcacgcgccgtttcccaatgagctgcacggc
gtgtcggtggacgattcgctgcgcgcgctcgagcatctgttcaaggccgatatcgaccca
acgcgcgtcgcggcgatcatcttcgaacccgtacagggcgaaggcggctttaatccggcg
ccggtcgaattcgtgcgcggcctgcgcaggatttgcgacgagctcggcattctgctcatc
gccgatgaagtgcagaccggcttcgcgcgcaccggcaagcttttcgcgatggagcactac
gatgtcgtccccgatctgatgacgatcgcgaagtcgctggcgggcggcatgccgctgtcg
ggcgtcgtcgggcgcgcggacatcatggacgcggcggcccccggcggtctcggtggcacg
tatgcgggcaacccgctggcggtggcggcggcgcacgcggtgctcgacatcatcgacgag
gaagcactgtgcgaacgcgctgtcgtgctgggcgacaagctcaaggcgaaactcgaatcg
ctcaggcgcgatgtgccgcagatcgcggatgtgcgcgggcctggtgcgatgatcgccgtc
gagttctgcacgccgggttccaatgatgcggatgctgcttttgccaagctcgtgcagacg
cgcgcgctggagcgcgggttgttgctgctcgtgtgtggggtgtattcgaacgtcgttcgg
ttcttgtttccgctcacgattcaggatcaggttttcgatgaggctttggggattcttgaa
gaggttttgatggagagtgttggcgtggcggtttga

DBGET integrated database retrieval system