KEGG   Burkholderia sp. RPE67: BRPE67_BCDS15240Help
Entry
BRPE67_BCDS15240  CDS       T03604                                 

Definition
(GenBank) putative trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00500  Starch and sucrose metabolism
bue01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bue00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BRPE67_BCDS15240
Enzymes [BR:bue01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BRPE67_BCDS15240
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BRPE67_BCDS15240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap DUF3459 hDGE_amylase SCAPER_N
Motif
Other DBs
NCBI-ProteinID: BAO89438
UniProt: A0A060PD41
LinkDB All DBs
Position
2:1591953..1595351
Genome map
AA seq 1132 aa AA seqDB search
MDTRVKRNKKASVLSDDPLWYKDAIIYQVHIKSFFDANNDGIGDFPGLLAKLDYIAELGV
DAIWLLPFYPSPRRDDGYDIADYRNVHPDYGTIADVKRFIQEAHARGIRVITELVINHTS
DQHPWFQRARHAKPGSAHRNYYVWSDTDKKYEETRIIFIDTEPSNWTHDPVAGQYYWHRF
YSHQPDLNFDNPAVLKEVLSVMRFWLDMGIDGLRLDAVPYLVEREGTNNENLPETHDILK
KIRATIDAEYPNRMLLAEANQWPEDVKEYFGDEDECHMAFHFPLMPRIYMSIASEDRFPI
TDIMRQTPDLGTTNQWAIFLRNHDELTLEMVTDSERDYLWNTYASDRRARLNLGIRRRLA
PLMERDRRRIELINSLLLSMPGTPVIYYGDELGMGDNIHLGDRDGVRTPMQWSSDRNGGF
SRADPEQLVLPPVMGSLYGYDAVNVESQSRDPHSLLNWTRRMLAVRRSTHAFGRGTIRFL
RPANRKILAYVRELEGHPPILCVANLSRAPQAVELDLSEFENSVPLEMTADSPFPAIGKL
TYLLTFPPYGFLWFQLCPGNLRPAWAQAPSEQLPEFVTMVIRAGQTGPTPENVRLLESEV
LPNYLSKRRWFASKDQKLHAVRLAALTTIEGAGFAFTEIEADVGDHCERYVLPLSIAWGT
ETTSPLYMQLALARVRRNRNIGHLTDAFAVPQFTYGVLRGLKSRAVVPTVQKSEIRFIPT
ARLDELNFYPADPPEIRWLAAEQSNSSLVIADKIVLKLVRRVVGGIHPEAEMSRYLTQLG
YANTGPLYGEVVRVDPQGVPHTLVILQGYIDNQGDAWNYALDYLRRTVDELAVAVEPDEH
QHERDVQAEGFQGYGNIAGIIGKRLGELHVALASPTEDEAFSPQRASHDDVKGWIDGTLA
LLNSALDILANKMSEFGEHERFLAQSLLDRRDMLVDAVKKLVAPGADALCIRIHGDFHLG
QVLMAQGDAYLIDFEGEPARALDERRRKTSPLRDVAGLLRSLSYASAAAQSTTENAPAQT
ADRKRALFERLRAFAEESFLREYMAAIASSPEIIAAEDVFQPLLDLFLIEKAAYEIRYEA
ANRPTWIGLPLRGLASLASRLLGDTGEPPAPGTRPVFGATKDNPDGTHHEQS
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
gtggatacaagggtgaagcgcaacaagaaggcgtcggttctcagcgacgatccgctctgg
tacaaggacgcgatcatctatcaggttcacatcaagtctttcttcgatgcgaacaacgac
ggcatcggcgattttcccggcctgctcgcgaaactcgactacatcgcggaactgggcgtc
gatgcgatctggctgctgccgttctatccatcgccgcgccgcgacgacggctacgacatt
gccgattaccgcaacgtgcatccggactacggcacgatcgcggacgtgaaacgcttcatc
caggaagcgcacgcgcgcggcatacgcgtgattaccgagctcgtcatcaatcacacgtcg
gatcagcatccgtggtttcagcgcgcgcggcatgcgaagccgggctcggcgcatcgcaac
tattacgtgtggtccgacacggacaagaagtacgaagagacgcgcatcatcttcatcgac
acggagccttccaactggacgcacgatccggtcgcgggccagtactactggcaccgcttc
tattcgcaccagcccgatctgaacttcgacaatcccgccgtgctcaaggaagtgctttcg
gtgatgcgcttctggctcgacatgggcatcgacgggctgcggctggacgcggtgccgtat
ctcgtcgagcgcgaaggcacgaacaacgagaatctgcccgagacgcatgacattctgaag
aagattcgcgcgacgatcgacgcggagtatccgaaccgcatgctgctcgcggaagcgaac
cagtggccggaagacgtgaaggagtatttcggcgacgaagacgaatgccacatggcgttc
cacttcccgctgatgccgcgcatctacatgtcgatcgcgagcgaagaccgctttccgatc
accgacatcatgcggcagacgccggacctcggcaccacgaatcaatgggcgatcttcctg
cgcaaccacgacgagctcacgctcgaaatggtcacggactccgagcgcgattacttgtgg
aacacgtatgcgagcgatcgccgcgcgcgcctgaacctgggcattcgccgccgtctcgcg
ccgctgatggagcgcgacagaaggcgcatcgaactgatcaactcgctcctgctgtcgatg
ccgggcacgccggtcatctattacggcgacgagctcggcatgggcgataacatccacttg
ggcgaccgcgatggcgtgcgcacgccgatgcaatggtcgtccgaccgcaacggcggcttc
tcgcgcgccgacccggaacagctcgtgttgccgccggtgatgggctcgctctacggctat
gacgcggtgaacgtcgaatcgcagagccgcgatccgcattcgctgctcaactggacgcgc
aggatgcttgctgtgcggcgctcgacacatgcattcggacgcggcacgatccgtttcctg
cggcccgcgaatcgcaagatcctcgcttatgtgcgcgagctcgaaggccatccgcccatt
ctgtgcgtcgcgaatctttcgcgcgcgccgcaggcggtggaactcgacctgtcggaattc
gagaactcggtgccgctcgaaatgaccgccgattcgcccttcccggccatcggcaagctc
acgtatctgctgaccttcccgccctatggctttctgtggttccagctttgccccggcaac
ctgcggcccgcgtgggcgcaggcgccttccgagcagttgcccgaattcgtgacgatggtg
attcgcgcgggccagaccggaccgacgccggagaacgtgcggctgctcgaatcggaagtg
ctgccgaattacctgagcaagcgccgctggttcgcatcgaaggatcagaagctgcatgcg
gtgcgcctcgccgcattgacgacgatcgaaggcgcgggcttcgcgttcaccgagatcgaa
gcggatgtcggcgatcattgcgagcgctacgtgctgccgctttccatcgcgtggggcacg
gaaacgacatcgccgctctacatgcagcttgcattggcgcgcgtgcggcgcaaccgcaac
atcggccatctcaccgacgccttcgcggtgccgcaattcacctacggcgtgctgcgcgga
ctgaagtcgcgcgccgtcgtaccgaccgtgcagaagagcgagatccgcttcattccgacc
gcgcgtctcgacgaactcaacttctatcccgccgatccgcccgaaatccgctggctcgcg
gccgagcaaagcaatagctcgctcgtgatcgcggacaagatcgtgctcaagctcgtgcgg
cgcgtcgtcggcggcattcatccggaagcggagatgagccgctatctgacgcagctcggc
tatgcgaacaccgggccgctgtatggcgaagtggtgcgcgtcgatccgcagggcgtgccg
catacgctcgtcatcctgcagggctacatcgacaatcagggcgatgcgtggaactacgcg
ctcgactatctgcgccgcaccgtcgatgaactcgccgtcgcggtcgagcccgacgagcat
cagcacgaacgcgacgtgcaagccgaaggtttccagggctacggcaatatcgcgggcatc
atcggcaagcggctgggcgaactgcatgtggcgctcgcatcgccgacggaagacgaggcg
ttttcgccgcaacgcgcatcgcacgacgacgtgaagggctggatcgacggcacgctcgcg
ctgctcaactccgcgctcgatattctcgccaacaagatgagcgaattcggcgagcacgag
cgcttccttgcgcaaagcctgctcgatcgtcgcgacatgctcgtcgacgccgtgaagaag
ctcgtcgcgcccggcgcggatgcgctgtgcatccgcattcatggcgatttccatctcggc
caggtgttgatggcgcagggcgacgcgtatctgatcgacttcgaaggcgagcccgcgcgc
gccctcgacgagcgccgcagaaagacgagccccttgcgcgatgtggcaggcctcttgcgt
tcgctgtcgtatgcgagcgcggcggcgcaatcgaccacggagaacgcgcccgcgcagacg
gcggaccgcaagcgcgcattgttcgagcggctgcgcgcgttcgccgaggagagcttcttg
cgggagtacatggcggcgatcgcatcgtcgccggaaatcatcgcggccgaagacgtgttt
caaccgttgctcgatctcttcctgatcgaaaaggccgcttacgaaatccgctacgaagca
gcgaaccggccgacctggatcggccttccgttgcggggtctcgcgtcgctcgcgagccgc
ttgctcggcgacacgggcgagccgcccgcgcccggcacgcggcccgtgttcggagcaacc
aaggacaatccggatggaacccaccatgaacaatcgtag

DBGET integrated database retrieval system