KEGG   Burkholderia sp. RPE67: BRPE67_CCDS00340Help
Entry
BRPE67_CCDS00340  CDS       T03604                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00564  Glycerophospholipid metabolism
bue01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bue00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BRPE67_CCDS00340
Enzymes [BR:bue01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BRPE67_CCDS00340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 HI0933_like NAD_binding_8 Pyr_redox_2 GIDA Thi4 Pyr_redox_3 PHA_gran_rgn
Motif
Other DBs
NCBI-ProteinID: BAO89636
UniProt: A0A060P403
LinkDB All DBs
Position
3:34255..35814
Genome map
AA seq 519 aa AA seqDB search
MHSTTPPERASLLRELDRTAVFDVVVIGGGASGLGTAVDAASRGYRTLLLEARDFAKGTS
SKATKLVHGGVRYLAQGNVPLVREALRERGLLARNAPHLVRPLGFIVPAYRTADRLLYGA
GLKIYDWLAGSLNLAASRSLGLAETREKSPMLADHLHGHALRGGTHYYDGQFDDARLAIT
LMRTLFDLGGIALNNAAVRGVRFDRDAGCHRVAVEDVETGDVLDVGARCLVNATGVWVDS
IRAMADPAARPIVAPSQGVHLTLPSRFLQSRDAILVPRTEDGRVLFVVPWHGHTIVGTTD
TPRRDLPLDPRASDEDIDFILATAADYLSVKPTRDDVLSVWAGLRPLVKGDADASTAALS
REHTIVTNATGMITVTGGKWTTYRLMAQQVVDLAVSNGLLSAAPCRTASLPLHGATAQQG
GRYGADAEFIARLPGADRVLVQASGLTEAQTRFAVRAELARSVEDVLARRDRALFLDAAE
ARRAAPDVARIVAEELGRNATWEAEEAARFDAFARGWML
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcactcgacgactccacccgagcgcgcatcgctgttgcgcgaactggaccgcacggcg
gtcttcgatgttgtcgtgatcggcggcggggcgagcggcctcggcacggccgtcgatgcg
gcgtcgcgcggctaccgcaccttgctgctggaagcgcgcgatttcgccaaaggcacgtcg
agcaaggccacgaagctcgtgcacggcggcgtgcgctatctcgcgcagggcaatgtcccg
ctggtgcgcgaagcgttgcgcgagcgcggcctgctcgcgcgcaatgcgccgcatctggtg
cgcccgctcggcttcatcgtgcccgcctaccggaccgccgacaggctgctctacggcgcg
gggctcaagatctacgactggctcgcgggttcgctcaatctcgccgcgagccgcagcctc
ggtcttgccgaaacgcgcgaaaaatcgccgatgctcgcggaccatctgcacggccacgcg
ttgcgcggcggcacgcactactacgacggccagttcgacgacgcgcgtctcgccatcacg
ctgatgcgcacgctgttcgatctcggcggcatcgcgctgaacaatgcggcggtgcgcggc
gtgaggttcgatcgcgacgcggggtgtcatcgggtcgcggtggaagacgtcgaaacgggc
gatgtgctcgacgtcggcgcgcgctgcctcgtcaacgcgacgggcgtgtgggtcgattcg
atccgcgccatggccgatcccgccgcgcggccgatcgtggcgccgagccagggcgtgcat
ctcacgttgcccagccgcttcctgcaaagccgcgacgcgattctcgtgccgcgcacggaa
gatggccgcgtgctgttcgtcgtgccgtggcacgggcatacgatcgtcggcacgacggac
acgccgcgtcgcgatctgccgctcgatccgcgcgcgagcgacgaggacatcgacttcatt
ctcgcgacggcggccgattatctctcggtgaaacccacgcgcgacgatgtgctgagcgtg
tgggccggtttgcgtccgctcgtgaagggcgacgccgatgcctcgacggcggcgctttca
cgcgagcacaccatcgtaacgaacgcgacgggcatgatcaccgtgacgggcggcaagtgg
acgacgtatcggctgatggcgcaacaggtggtcgatcttgccgtcagcaacgggctgttg
tccgccgcgccgtgccgcacggcctcgttgccgctgcacggcgcgacggcgcagcagggc
ggccgatacggcgccgatgccgagttcatcgcgcgattgccgggcgcggaccgcgtgctc
gtgcaggcgagcgggctgacggaggcgcagacgcgcttcgcggtgcgcgcggagcttgcg
cgctcggtggaagacgtgctcgcgcgccgcgatcgcgcgctctttctcgacgccgcagag
gcgcgccgcgcggcgccggacgtggcgcggatcgtcgcggaggaactgggacgcaacgcg
acgtgggaagcggaggaagccgcgcgtttcgacgccttcgcgcggggctggatgttgtga

DBGET integrated database retrieval system