KEGG   Burkholderia sp. RPE67: BRPE67_CCDS08470Help
Entry
BRPE67_CCDS08470  CDS       T03604                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bue  Burkholderia sp. RPE67
Brite
KEGG Orthology (KO) [BR:bue00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bue01001]
    BRPE67_CCDS08470
Enzymes [BR:bue01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BRPE67_CCDS08470
Protein kinases [BR:bue01001]
 Serine/threonine kinases: Other
  Bacterial family
   BRPE67_CCDS08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-ProteinID: BAO90449
UniProt: A0A060PG99
LinkDB All DBs
Position
3:946445..947794
Genome map
AA seq 449 aa AA seqDB search
MPSADDVPATLGRYVIERVLGRGAMGIVYLAFDPQIERQVALKTLHRLAADDATAAHELT
ARFLNEARAAGRLVHPNIVAIYDYGEADDIAFITMEYVRGESLAARLARHARTATPMNPA
SALRWFAQLLDALDYAHEAGIVHRDIKPANLLIAPRGECKIADFGIARLDTSALTQTGTL
LGTPSYMSPEQFTGDTVDARADLFSAAVVLYEMLTGVCPFTGTPAAVMRGILDDMPPLPS
SVARGVPAFIDDLVMKGMAKRPDARFASAREWRDAVLAALAADAQDDAERTVIAARVPPA
APDAFDAPPAFAPDMIAQIEKRLASHVGPVASLLMRRACANAADIDTLRGRLAAHLPTDE
ARRDLDALLMRLAAATPPSRGARAQTVSAESVNEAAARLTTYLGPVARIVARRAAAQSAD
LPAFYARLLDAVPDEHRETLRREWGIAGG
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgccatcggcagacgacgtgccggcaacgctggggcgctacgtcatcgagcgcgtgctc
gggcgcggcgcgatgggcatcgtctatctcgcgttcgatccgcagatcgagcggcaggtc
gcgctgaagacactgcaccgccttgccgccgacgacgccaccgccgcgcacgaactgacc
gcgcgctttctgaacgaagcgcgcgcggccggacgtctcgtgcatccgaacatcgtcgcg
atctacgactacggcgaagccgacgacatcgccttcatcacgatggaatacgtgcgcggg
gaaagcctcgccgcacgtctcgcccggcacgcgcgcacggccacgccgatgaatccggca
agcgcgcttcgctggttcgcgcaactgctcgatgcactcgactacgcgcacgaggcgggc
atcgtgcatcgcgacatcaaaccggccaatctgctgatcgcgccgcgcggcgaatgcaag
atcgccgatttcggcatcgcccgtctcgacacgtcggcgctcacccagacgggcaccctg
ctcggcacgccgagttacatgtctccggaacagttcaccggcgataccgtcgatgcgcgc
gccgatctgttctccgctgccgtcgtgctctatgaaatgctcaccggcgtttgcccgttc
accggcacgccggcggcggtcatgcgcggcattctcgacgacatgccgccgcttccatcg
agcgtcgcgcgcggcgttcccgcttttatcgacgatctcgtgatgaagggcatggcgaag
cgcccggacgcacgtttcgcttcggcgcgcgaatggcgcgacgcggtgctggccgcgctc
gccgccgatgcacaggacgatgccgaacgcacggtgatcgccgcgcgcgttccgcccgcc
gcgccggatgcgttcgatgcgccgcccgccttcgcgccggacatgatcgcgcaaatcgaa
aagcgcctcgcgagccacgtgggtccggtcgcatcgctgctgatgcgccgcgcctgcgcg
aacgcggcggacatcgatacgctgcgcgggcggctcgcggcacatctgccgaccgacgaa
gcgcgccgcgatctcgatgcgctcctgatgcgccttgcagccgctacgccgccttcgcgc
ggcgcacgggcgcagaccgtcagcgcggaaagcgtgaacgaggccgcggcgcggctcacg
acttatctcggcccggttgcgcgcatcgtcgcacgccgcgccgccgcgcaatccgccgat
ctgcccgctttctacgcgcgtctgctcgacgccgtgcccgatgagcatcgcgagaccttg
cggcgcgaatggggcatcgcgggcggctag

DBGET integrated database retrieval system