KEGG   Burkholderia sp. RPE67: BRPE67_CCDS12550Help
Entry
BRPE67_CCDS12550  CDS       T03604                                 

Definition
(GenBank) phenol 2-monooxygenase
  KO
K16246  phenol/toluene 2-monooxygenase (NADH) P5/A5 [EC:1.14.13.244 1.14.13.243]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00361  Chlorocyclohexane and chlorobenzene degradation
bue00362  Benzoate degradation
bue00623  Toluene degradation
bue01100  Metabolic pathways
bue01120  Microbial metabolism in diverse environments
bue01220  Degradation of aromatic compounds
Module
bue_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:bue00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BRPE67_CCDS12550
   00361 Chlorocyclohexane and chlorobenzene degradation
    BRPE67_CCDS12550
   00623 Toluene degradation
    BRPE67_CCDS12550
Enzymes [BR:bue01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     BRPE67_CCDS12550
    1.14.13.244  phenol 2-monooxygenase (NADH)
     BRPE67_CCDS12550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 Fer2 Fer2_4 NAD_binding_6
Motif
Other DBs
NCBI-ProteinID: BAO90857
UniProt: A0A060PA29
LinkDB All DBs
Position
3:1369412..1370476
Genome map
AA seq 354 aa AA seqDB search
MSYQLTIEPIGQTIEIEDEQTILDACMRAGVWLPHACCHGLCATCKVQVVDGEIEHGPAS
PFALMDFERDERKCLACCATAQSDLTIEADIDEDEDARHFPVRDYTGRVKEMIDLTPTIK
GIFVELDGNGIEFQAGQYVNVHIPGEDMPRAFSLADQPASRNVIELNVRRVPGGKGTGYL
HDQIRSGDEIRFSGPYGRFFVRKSDPQPVILIAGGSGLSSPKAMLIDMLEENDARHITLV
YGARNRSELYYDGLFQRLQKEHANFTYVPALSDEPADSSWEGFRGFVHDAAKAHFDGVFR
GHKAYLCGPPVMIEAAIRTLMQGQLFERDIYTEKFLTSADGADALAKSPLFKSI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagctaccaactgaccatcgagccgatcgggcagacgatcgagatcgaagacgagcag
accattctcgatgcgtgcatgcgcgccggcgtatggctgccgcacgcgtgctgtcacggc
ctgtgcgcgacctgcaaggtgcaggtggtggacggcgagatcgagcatggaccggcgtcg
ccgttcgcgctgatggatttcgagcgcgacgagcgcaagtgcctcgcgtgctgcgcgacg
gcgcaatcggacctgacgatcgaagccgacatcgacgaagacgaggacgcccggcacttt
cccgtgcgcgactacacgggccgcgtgaaagagatgatcgatctcacgccgacgatcaag
ggcatcttcgtcgagctcgacggaaacggcatcgagttccaggcgggccagtacgtgaac
gtgcacattccgggcgaggacatgccacgcgcgttctcactcgcggaccagccggcctcg
cgcaacgtgatcgaactgaacgtgcggcgcgtgccgggcggcaagggcacgggctatctg
cacgatcagatccgatcgggcgacgagattcgcttcagcgggccctacggacgcttcttc
gtgcgcaagtcggacccgcagccggtgatactcattgcgggcggctccggtctgtcgagc
ccgaaggcgatgctcatcgacatgctggaagagaacgacgcgcggcatatcacgctcgtc
tacggcgcgcgcaaccgctcggagctgtactacgacgggctctttcagcggctgcagaag
gagcacgcgaatttcacctacgtgcccgcgctgtccgacgaaccggcggactcgtcatgg
gaaggctttcgcggcttcgtgcatgacgcggcgaaggcgcatttcgacggcgtgtttcgc
gggcacaaggcttatctgtgcgggccgcccgtgatgatcgaagcggccatccgcacgctc
atgcagggccagctcttcgagcgcgacatctataccgagaagttcctcaccagcgcggac
ggcgccgatgcgctcgcgaagagtccgctgttcaaatcgatctaa

DBGET integrated database retrieval system