KEGG   Burkholderia sp. RPE67: BRPE67_DCDS07620Help
Entry
BRPE67_DCDS07620  CDS       T03604                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
bue  Burkholderia sp. RPE67
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAO91917
UniProt: A0A060PD14
LinkDB All DBs
Position
p1:816789..818267
Genome map
AA seq 492 aa AA seqDB search
MQATDRTIPLKHPSAFYIDGQWTPAPSSDTFEVLDCSTERVAAHVARADAGIASRAIDAA
RRAFDHGPWPRMTPGERSVYLEKIAQHLEAANDAFARGWSIESGILQRIAKPRIGQFLGA
AFRQYAAMAETYPFVEPRRSATGHQAYAVKEPAGVVLAIVPWNGPAALLAYKVAPALLAG
CTVVVKPSPEAPTSAYLFAQICDEIGLPPGVVNVLTADRDVSETMVRNPAVDKITFTGST
SAGRSISEAAAGRIARVTLELGGKSAALVLDDYDIDAAAQALGQPYFSYLTGQVCHSLTR
IIVPRAKHDTMVEALSAAARAMVPGDPFDDGTTVGPLATARQRDTVERYVAKGIAEGATL
AAGGARPSHLSRGFFFEPTVFGNVDNRAAIAQEEIFGPVLSVIAADSEAHAIELANDSIF
GLNAVVFTSDAGRALNVARRLRTGSVGHNASRTDFSIGFGGFKQSGIGREGGVEGLNAFV
ESKTIVLDQPLA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaccgaccgaacgattcctctgaagcatcccagcgccttctacatcgatggc
cagtggacgcccgcgccctcctccgacaccttcgaggtgctcgactgcagcacggaacgc
gtcgcggcgcacgtcgcacgagccgatgcgggcatcgcctcgcgcgccatcgacgccgcg
cgccgcgccttcgaccatgggccatggccgcgcatgacgcccggcgagcgctcggtctat
ctggaaaaaatcgcgcaacacctggaagcggcgaacgacgcgttcgcgcgcggctggagc
atcgaatcgggcatccttcagcggattgccaaaccgcgcatcggccagtttctcggcgcg
gcgtttcgccagtacgccgcgatggccgagacgtatccgttcgtcgaaccgcgccggtca
gccaccggacaccaggcttacgcggtgaaggaaccggccggcgtggtacttgcgatcgtt
ccctggaacggtcctgccgcgctgctcgcctacaaggtcgcgccggcgctgctcgcgggc
tgcacggtcgtcgtcaagccgtcgccggaagcgcccacgtcggcgtatctgttcgcgcag
atctgcgacgagatcggcttgccgcccggtgtcgtcaacgtcctgacggccgaccgcgac
gtttccgaaacgatggtccgcaatcccgcagtcgacaagatcacctttaccggctccaca
tcggctggccgcagcatcagcgaggcggcagccggccggatcgcgcgcgtcacgctggaa
ctgggcggcaaatcggcggcgctcgttctcgacgattacgacatcgacgcggcggcccag
gcgctcggccaaccgtacttcagctatctgaccggccaggtgtgccacagcctgacgcgc
atcatcgttccgcgcgcgaagcacgacaccatggtggaagcgttgagcgcggctgcgcgt
gcgatggtgcccggcgatcccttcgacgacggcacgacggtcggtccgcttgcgaccgca
cgccagcgcgacaccgtcgagcgctacgtggccaagggcatcgccgaaggtgcgacgctc
gcggccggcggtgcgcgtccgagccacctgtcgcgtggcttcttttttgagccgactgtg
ttcggaaatgtcgacaaccgggcggcaatcgcgcaggaagagatcttcggaccagtgcta
tcggtgatcgctgcggacagcgaagcgcatgcgatcgaactcgccaacgattccatcttc
gggttgaacgccgtggtgtttacgtccgacgccgggcgtgcactgaatgtggcacggcgg
ctgcgcaccggcagtgtcggccataacgcgtcgcgcaccgacttctccatcggcttcggt
ggattcaagcaatccggtatcggccgcgaaggcggcgtcgaagggctgaatgcgttcgtc
gaatcgaagaccatcgtgctcgaccagccgctggcataa

DBGET integrated database retrieval system