KEGG   Buttiauxella sp. 3AFRM03: D8682_03785Help
Entry
D8682_03785       CDS       T05676                                 

Gene name
trpD
Definition
(GenBank) bifunctional anthranilate synthase glutamate amidotransferase component TrpG/anthranilate phosphoribosyltransferase TrpD
  KO
K13497  anthranilate synthase/phosphoribosyltransferase [EC:4.1.3.27 2.4.2.18]
Organism
buf  Buttiauxella sp. 3AFRM03
Pathway
buf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
buf01100  Metabolic pathways
buf01110  Biosynthesis of secondary metabolites
buf01130  Biosynthesis of antibiotics
buf01230  Biosynthesis of amino acids
Module
buf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:buf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    D8682_03785 (trpD)
Enzymes [BR:buf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     D8682_03785 (trpD)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     D8682_03785 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 GATase Glycos_trans_3N Peptidase_C26 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: AYN26193
UniProt: A0A3G2I9Z1
LinkDB All DBs
Position
547604..549199
Genome map
AA seq 531 aa AA seqDB search
MADILLLDNIDSFTYNLADQLRANGHNVVIYRNHVPAQTLIERLATMDNPVLMLSPGPGA
PSEAGCMPELLTRLRGKLPIIGICLGHQAIVEAYGGYVGQAGEILHGKASIISHDGEAMF
AGLPNPLPVARYHSLVGSNIPAGLTINAHFEGMVMAVRHDADRVCGFQFHPESILTTHGA
RLLEQTLDWALLKLKQANTLQPILDKLYQAQTLSREESHQLFAAIVRGELKPEQLAAALV
SMKVRGEHPNEIAGAATALLEAAAPFPSPDYPFADIVGTGGDGSNSINISTASAFVAAAV
GLKVAKHGNRSVSSKSGSSDLLAAFGINLEMSAESSRKALDDLGVCFLFAPKYHTGFRHA
MPVRQQLKTRTLFNVLGPLINPAHPQMALIGVYSAELVLPIAETLRVLGYKRAAVVHSGG
MDEVSLHATTQVAELHDGEIKSYQLEATDFGLPAYHQDQLAGGTPEENRDILTRLLQGKG
ETAHESAVAANVAMLMRLHGQEDLKANAQRVLEVLRSGAAYDRVTALAGRG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggctgacattctgctgctcgataacatcgactcgttcacctataaccttgccgatcag
ctgcgtgccaatggtcacaatgtggttatttaccgcaatcacgttcctgcacagacttta
attgaacgtctggcgaccatggacaacccggtgctgatgctttcgccaggccctggtgcg
ccaagcgaagcaggttgtatgcctgaactgttaacgcgtctgcgtggcaaattaccgatt
attggtatttgcctgggccaccaggcgattgttgaagcttacggcggttatgtcggtcag
gcaggtgaaattctgcatggcaaagcgtcgattatttctcacgatggcgaggcgatgttt
gccggtttgcctaacccgcttcctgtagcccgttatcactcactagttggcagcaatatt
ccggcgggtttaaccattaacgcccattttgagggcatggtgatggcggttcgccacgat
gcagatcgggtgtgtggtttccagttccatccggaatccattctgaccacccatggtgca
cgtttgcttgaacaaactctcgactgggcgctgctgaaattaaaacaagccaacacgctg
caacctattctcgacaaactttatcaggcgcaaaccctgagccgcgaagagagccaccag
ctgtttgccgcgattgtgcgtggcgagttgaaacctgaacaactggcggcggcgctggtc
agtatgaaagtacgtggtgaacatccgaatgaaatcgctggtgcagccaccgcgttgctg
gaagccgcagcaccgttcccaagcccggactatccgtttgctgacatcgtcggtaccggt
ggcgatggcagtaacagcatcaatatttccaccgccagcgcctttgttgccgccgcggtt
gggctgaaagtagccaaacacggtaaccgtagcgtttccagcaaatctggctcgtcggat
ttactggccgccttcggtattaacctggaaatgagtgctgaatcgtcgcgtaaagccctt
gacgatttgggcgtctgcttcctgtttgcaccgaaataccacaccggttttcgccacgcg
atgcctgtgcgccagcagctaaaaacgcgcaccttgttcaatgtgcttgggccgttgatt
aaccccgcacatccacagatggcgctgattggtgtctacagtgcggaactggtgttgccg
attgcagaaacgttgcgtgtgctgggatacaaacgtgcggcagtggtacacagcggcggt
atggatgaagtttctctgcatgccaccactcaggttgccgaacttcacgatggcgagatc
aaaagctaccaactggaagccaccgactttggcctgccagcttatcatcaggatcagctg
gcaggcggtacgccagaagaaaatcgtgacattctcacccgcctgttacaaggtaaagga
gagactgctcatgagtctgcagtagccgcgaacgtcgctatgttaatgcgtctgcatggg
caagaagatctaaaagcgaacgcacaacgagtgctggaagtgttgcgcagcggcgcggca
tatgaccgggttacagcactggccggaagaggataa

DBGET integrated database retrieval system