KEGG   Buttiauxella sp. 3AFRM03: D8682_03960Help
Entry
D8682_03960       CDS       T05676                                 

Gene name
gstA
Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
buf  Buttiauxella sp. 3AFRM03
Pathway
buf00480  Glutathione metabolism
buf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D8682_03960 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:buf02000]
    D8682_03960 (gstA)
Enzymes [BR:buf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     D8682_03960 (gstA)
Transporters [BR:buf02000]
 Other transporters
  Pores ion channels [TC:1]
   D8682_03960 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_C_3 GST_N_2 GST_C_2 GST_C_6 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AYN26226
UniProt: A0A3G2IA16
LinkDB All DBs
Position
584143..584745
Genome map
AA seq 200 aa AA seqDB search
MKLYYKAGACSLSPHIILRETGIDFSLVKVDLAAKKTEAGDDYLEVNAKGQVPALLLDDG
SLLTEGVAIVQYLADKVPDRQLLAPAGSMTRYHTLEWLNYIATELHKGFSPLFNPATPDE
YKTIARAALEKKFKYVDEELNDKQWLMGLRFSVADAYLFTVLRWANAVKLNLEGLSNIEA
FMERMKARPAVAAALTAEGI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtattataaagctggtgcctgttccctctcccctcatattattctgcgtgaa
acgggtattgatttctctctggttaaggtcgatttagcggcgaagaaaaccgaagcaggt
gatgactatcttgaagtcaatgcgaaggggcaagtccctgcgttgctgctggatgacggt
tcactgctaactgaaggcgtggcgattgttcagtatttggcggataaggtacctgaccgc
caactactcgctccggcaggcagcatgacgcgttaccacactctcgaatggctgaactac
atcgcgaccgagttgcacaagggcttctccccgttgttcaacccagcaacgcctgacgaa
tacaaaaccattgcgcgtgccgcactggagaagaaattcaaatacgttgacgaagagctg
aatgataaacagtggctgatgggcctgcgctttagcgtggcagatgcgtatttgtttacc
gtgctgcgctgggcgaatgcggtgaaactgaatctggaagggctgagcaacatcgaagcg
tttatggagcgtatgaaagcgcgtccggcagtggctgctgcattaacagctgaagggatt
taa

DBGET integrated database retrieval system