KEGG   Buttiauxella sp. 3AFRM03: D8682_07410Help
Entry
D8682_07410       CDS       T05676                                 

Definition
(GenBank) bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
buf  Buttiauxella sp. 3AFRM03
Pathway
buf00061  Fatty acid biosynthesis
buf01100  Metabolic pathways
buf01212  Fatty acid metabolism
Module
buf_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:buf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    D8682_07410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:buf01004]
    D8682_07410
Enzymes [BR:buf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     D8682_07410
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     D8682_07410
Lipid biosynthesis proteins [BR:buf01004]
 Fatty acid synthase
  Component type
   D8682_07410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AYN26824
UniProt: A0A3G2IBK8
LinkDB All DBs
Position
1231270..1231788
Genome map
AA seq 172 aa AA seqDB search
MVDKRESYTKEDLLASGRGELFGAEGPRLPAPSMLMMDRVVKMTEDGGNFDKGYVEAELD
INPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKLAGQILP
TAKKVTYRIHFKRVINRRLIMGLADGEVLVDGRVIYTATDLKVGLFKDTTAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacgcgaatcctatacaaaagaagatcttcttgcctctggtcgtggagaa
ctgtttggcgctgaaggcccacggttacctgcgccatccatgctgatgatggaccgcgtg
gtcaagatgaccgaagacggtggtaacttcgataaaggttacgttgaagcagaattagat
attaatcctgatctgtggttctttggctgccactttatcggcgatccggtaatgcctggt
tgtctgggccttgatgcgatgtggcagctggtcggtttctacctgggctggctcggtggt
gaaggtaaaggtcgtgctctgggtgtgggtgaagttaaactcgcgggtcagattctgcca
actgcgaagaaagttacctatcgtattcatttcaaacgcgtcatcaatcgccgcctgatc
atgggcctggcagatggtgaagtactggttgatggccgtgtcatttacaccgctaccgat
ctgaaagtgggtctgttcaaagataccactgctttctag

DBGET integrated database retrieval system