KEGG   Buttiauxella sp. 3AFRM03: D8682_09855Help
Entry
D8682_09855       CDS       T05676                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
buf  Buttiauxella sp. 3AFRM03
Brite
KEGG Orthology (KO) [BR:buf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D8682_09855 (ahpF)
Enzymes [BR:buf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D8682_09855 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored FAD_binding_3 Glutaredoxin Thi4 K_oxygenase AlaDh_PNT_C DAO NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AYN27250
UniProt: A0A3G2ICW0
LinkDB All DBs
Position
1786373..1787941
Genome map
AA seq 522 aa AA seqDB search
MLDNNMKTQLKAYLERLTKPVELIATLDDGAKSTEIKELLAEIAELSDKVTFTINNDLPV
RKPSFLITNPGSDKGPRFAGSPLGHEFTSLVLALLQTGGHPSKESQDLLEQIREIDGDFH
FETFYSLSCHNCPDVVQALNLMSVLNPRISHIAIDGGVFQNEIQERNVMGVPAVFLNGKE
FGQGRMTLAEIVSKIDTGAEKRAAEALNKREAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDTQSASKLIPAKTAG
GLHQIQTASGATLSARSIIIATGAKWRNMNVPGEEQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQNKVRSLKNVDIILNAQTLEVKGD
GSKVTGLQYKDRLTENVHEIELAGIFVQIGLLPNTNWLEGSVERNRMGEIIIDAKCETTV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTPNNS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaacaacatgaaaacccaactcaaagcttaccttgagagattaaccaaacct
gttgagttgattgccacgctggacgacggcgcaaaatcaaccgagataaaggaactgctg
gcagagattgctgagttatctgacaaagttactttcacgattaataacgatttaccggta
cgcaaaccgtcgtttctgattaccaatccaggttccgataaaggcccgcgctttgcaggt
tctccactcggccacgaatttacttctctggttttagctttgctacaaaccgggggacat
ccgtcgaaagagtcacaagatttgcttgagcaaatccgcgaaattgacggcgatttccat
tttgaaactttttattcgctctcctgccacaactgcccggacgtggtgcaggcgctgaac
ctgatgagcgtgttaaacccgcgcatcagccatatcgccattgacggcggcgtattccag
aatgaaattcaggagcgcaacgtgatgggtgtgcctgcggtgttcctgaacggcaaagag
ttcggtcaaggccggatgacgctcgcggaaattgtcagcaaaattgatactggtgccgaa
aagcgcgcagccgaagccctgaacaaacgggaagcttacgatgtattaattgtcggtagc
ggcccagcgggtgctgctgctgcggtttactcggcacgtaaaggcattcgcaccggcctg
atgggcgaacgttttggcggccaggtattagataccgttgatatcgaaaactacatttcg
gtaccgaaaaccgaagggcagaaactggctggcgcactgaaagcccacgttgatgattac
gatgtggatgttatcgacacgcaaagtgccagcaaattaataccggctaaaaccgcaggc
ggtttgcaccagattcaaacggcttccggcgcaacacttagcgctcgcagcattatcatt
gcgacgggagcgaagtggcgcaatatgaacgtgccaggcgaagaacagtatcgcaccaaa
ggcgtgacttactgcccacactgcgacggcccactgtttaaaggcaaacgcgtggcggtg
atcggcggcggtaactctggggttgaagcagcaattgatctggcgggtatcgtcgaacac
gttacgctgcttgagttcgccccagaaatgaaagccgaccaggtgttgcagaataaagtc
cgcagcctgaaaaacgtcgacattattttgaatgcgcaaacgctggaagtgaaaggcgat
ggcagcaaagtcactggtttacagtacaaagatcgcctgaccgaaaatgtacatgagatt
gaactggcggggattttcgtgcaaatcggtctgttgccaaacaccaactggctggaaggc
agcgtagagcgcaaccgcatgggtgaaatcatcattgatgcgaaatgtgaaaccactgtg
aagggtgtttttgctgctggcgactgcactaccgtgccctataaacaaattattatcgcc
actggcgaaggtgcgaaagcttcactgagcgcatttgattacctgattcgtaccccaaat
aactcataa

DBGET integrated database retrieval system