KEGG   Buttiauxella sp. 3AFRM03: D8682_13595Help
Entry
D8682_13595       CDS       T05676                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
buf  Buttiauxella sp. 3AFRM03
Pathway
buf00250  Alanine, aspartate and glutamate metabolism
buf00410  beta-Alanine metabolism
buf00430  Taurine and hypotaurine metabolism
buf00650  Butanoate metabolism
buf01100  Metabolic pathways
buf01110  Biosynthesis of secondary metabolites
buf01120  Microbial metabolism in diverse environments
buf02024  Quorum sensing
Module
buf_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:buf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    D8682_13595
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D8682_13595
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D8682_13595
   00430 Taurine and hypotaurine metabolism
    D8682_13595
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    D8682_13595
Enzymes [BR:buf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     D8682_13595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AYN27922
LinkDB All DBs
Position
complement(2579397..2580794)
Genome map
AA seq 465 aa AA seqDB search
MTTLIQPVENENDDVYASIELSTALPKNAFPVNESNPRNVFHAIHDELMLDGNSRQNLAT
FCQTWVDDEIRQLMDLSIDKNMIDKDEYPQTAEIEQRCVNMLADLWHSPSATDTMGCSTI
GSSEAAMLGGLALKWRWRKHRELAGKSTDKPNMVCGPVQICWHKFARYFDVELREVPLEG
NRLMMTAEEALKYIDENTIGVVPTLGITFTCQYEPVKEIHDALDDLFERTGLDIPMHVDA
ASGGFLAPFCATEIDWDFRLPRVKSINASGHKFGLAPLGAGWVVWREKQDLPEELVFNVN
YLGGNMPTFALNFSRPGGQIVAQYYNFLRLGCEGYRKIHMACYHTAQYLAREIAAIGPFE
VIYDGNQQNGIPGLTWTLKADQRNCGYTLYDLADRLRSRGWQVPAYSMPTHREDLVVQRI
LVRHGMSTDLAELLISDLKRTLAALEKNPVTHSLTAEEAGGFNHA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacttattcagccagtcgaaaatgaaaatgacgatgtttatgcttcgatagag
ttatctaccgcactgcctaaaaacgcatttccggtcaacgaaagtaatccacgcaatgtt
tttcatgctattcatgatgaattaatgctggatggtaattcccgccagaacctggcgact
ttttgccagacttgggtggatgacgaaatccgccagctgatggatctttccatcgacaaa
aacatgattgataaagatgagtacccacagactgctgagatagagcagcgttgcgtgaac
atgctcgcggacctttggcattctccgtcagccaccgacaccatgggctgttccactatc
ggttcttccgaagccgcgatgctgggcggtctggcgctgaaatggcgctggcgcaaacac
cgtgaactggcaggaaaatctaccgataagccaaatatggtgtgcggcccggtgcagatt
tgctggcataaattcgcccgttattttgacgtggagctgcgcgaagtgccgctggaaggc
aaccgtctgatgatgacagccgaagaagcgctgaaatatatcgacgaaaacaccattggc
gtagtgccaactttggggattaccttcacctgccagtacgagccagtgaaagagattcac
gatgcgcttgatgatttgtttgagcgcacagggctggatattccgatgcacgttgatgcc
gccagcggtggcttcctggcgccattctgcgccacagaaatcgactgggattttcgtctg
ccacgagtgaaatctatcaacgcgtcaggtcataaattcggccttgcaccgctcggtgcc
ggttgggtggtatggcgtgaaaaacaagatctgccagaggaacttgtttttaacgttaac
tacctcggcggcaatatgccgacctttgcgctgaacttctcacgtcctggtgggcaaatt
gtcgctcagtattacaacttcctgcgcctgggttgcgaaggttatcgcaaaattcacatg
gcctgttatcacaccgcccagtatctggcgcgtgaaatcgccgctatcggcccattcgag
gttatctatgatggcaaccagcaaaatggcattccaggactgacctggacgctaaaagct
gaccaacgcaattgtggctacacgctgtacgatctggctgaccgtttacggagccgtggc
tggcaggtgcctgcttattccatgccgactcaccgcgaagatctagtggtgcagcgcatt
ctggtgcgccatggcatgagtaccgatttggccgaattattgataagcgacctgaaacgc
acgctcgcagcactggaaaaaaatcctgtcacgcattcgctgactgccgaggaagcgggc
ggcttcaaccacgcataa

DBGET integrated database retrieval system