KEGG   Buttiauxella sp. 3AFRM03: D8682_13930Help
Entry
D8682_13930       CDS       T05676                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
buf  Buttiauxella sp. 3AFRM03
Pathway
buf00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:buf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D8682_13930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:buf02000]
    D8682_13930
Enzymes [BR:buf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     D8682_13930
Transporters [BR:buf02000]
 Other Transporters
  Pores ion channels [TC:1]
   D8682_13930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C Tom37 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AYN27984
UniProt: A0A3G2IEU1
LinkDB All DBs
Position
complement(2666626..2667288)
Genome map
AA seq 220 aa AA seqDB search
MLIVHHLNNSRSQRILWMLEELQVPYQIVRYQREPTMLAPESLKSVHPLGKSPVVEDNGN
ILAESGAIIEYLQETYDLESRFKPISSQEKLRYRFWLHYAEGSLMPLLMMKLVFGSLGKE
PVPWLLRPVGNLLGQGVQKAYLNKQIMTHARYLEDSLQKNPWFAGQAFSAADIQMSFPVI
ALLSRGGINDLPNLQNWHSKVQMRPAWQRAIQQGGPFDIP
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcttatcgtccatcacctcaataactcccgctcgcagcgtattttatggatgcttgaa
gaactgcaagtgccgtaccagattgttcgctatcagcgcgaaccgaccatgctggcacct
gagtcattaaaatctgtgcacccgttagggaagtcgccagtggtggaagataacggcaat
attctcgccgagtcaggggcaatcattgaatatctgcaagaaacctacgatttagaaagc
cgcttcaaaccgatttccagccaggaaaaactgcgttatcgcttttggctgcattacgcc
gaaggatcgttaatgccattgctaatgatgaaactggttttcggcagcctgggaaaagag
cctgttccgtggttactgcgtccggttggtaatctactggggcaaggtgtgcaaaaggcc
tatctgaataaacagattatgacccatgcgcgttatctcgaagattcgctacaaaaaaat
ccgtggtttgcaggtcaggcgtttagtgcggcagatatacagatgagtttcccggttatc
gcgctgctctctcgcggcggcatcaacgatttaccgaatctgcagaattggcacagtaaa
gtgcaaatgcgccctgcctggcagagagcaattcagcaaggtgggccgttcgacatccct
taa

DBGET integrated database retrieval system