KEGG   Buttiauxella sp. 3AFRM03: D8682_17050Help
Entry
D8682_17050       CDS       T05676                                 

Definition
(GenBank) carboxypeptidase/penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
buf  Buttiauxella sp. 3AFRM03
Pathway
buf00550  Peptidoglycan biosynthesis
buf01100  Metabolic pathways
buf01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:buf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D8682_17050
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    D8682_17050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:buf01003]
    D8682_17050
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:buf01011]
    D8682_17050
Enzymes [BR:buf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     D8682_17050
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     D8682_17050
Glycosyltransferases [BR:buf01003]
 Polysaccharide
  Bacterial polysaccharide
   D8682_17050
Peptidoglycan biosynthesis and degradation proteins [BR:buf01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   D8682_17050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase DUF3502
Motif
Other DBs
NCBI-ProteinID: AYN28533
UniProt: A0A3G2IGC0
LinkDB All DBs
Position
complement(3366643..3369195)
Genome map
AA seq 850 aa AA seqDB search
MKFVKYLLILAVCCILLGAGSIFGLYKFIEPQLPDVATLKDVRLQIPMQVYSADGELIAQ
YGEKRRIPVTLQQIPPVMVKAFIATEDSRFYEHHGVDPVGIFRAASVALFSGHASQGAST
ITQQLARNFFLSPERTLMRKIKEVFLAIRIEQLLTKDEILELYLNKIYLGYRAYGVGAAA
QVYFGKPIDQLTLSEMAVIAGLPKAPSTFNPLYSMDRATSRRNVVLSRMLSENYITQAQY
DEARNQPIDANYHAPEIAFSAPYLSELVRQDMVARYGEKAYEDGFKVYTTIARKNQQAAQ
QAVRNNVIAYDMRHGYRGPSNVLWKVGETPWDQTRIVDSLKNLPVYGPMFPAVITQATPT
EATAMMADGSAVSISMEGMRWARPYRSDTAQGPTPRKVTDVVQAGQQIWVRKVEESWWLG
QVPDVNSALVSINPHDGAVVALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGL
TLASVLNDVPISRWDAGAGSDWRPKNSPPEYAGPIRLRQGLGQSKNVVMVRAMRAMGVDY
AAEYLQRFGFPAQNIVHTESLALGSASFTPMQVARGYSVMANGGFLVDPYYISKIETEVG
GTLFEAKPKVACADCDIPVIYGETQKSNVLENQDVEDVAQSQEQQNASVPMPKLEQANSE
LVAQSSPPEYAPHVINTPLAFLIKSALNSNIYGEPGWQGTGWRAGRDLKRNDIGGKTGTT
NSSKDAWFSGYGPGVVTSVWIGFDDHRRDLGRTSASGAIKDQISGYEGGAKSAQPAWDDF
MKAALEGVPEEPLTPPPGIVTVNIDRYTGQLANGGSSRPEFFIEGTQPTQQAVHEVGTTI
IDNGESHELF
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcgtaaagtatttattaatccttgcagtgtgttgcattctgctgggagcaggc
tcgatcttcgggctctacaaatttattgagccgcagttgcctgatgtcgccacgcttaaa
gacgtgcgactccagatcccaatgcaggtttatagcgccgatggtgagctaatcgcacaa
tacggggaaaaacgccgtatcccggttacgctccagcaaattccgccagtgatggtgaaa
gcgtttattgcaactgaggacagccgtttctacgagcaccacggtgttgaccctgtcggg
atcttccgtgctgccagtgtggcgctgttttcgggtcacgcctctcaaggtgcgagtacc
atcacgcagcagttggcacgtaacttcttcttgagccctgaacgcacgctgatgcgtaag
ataaaagaagtgttcctggcgattcgtatcgagcagttgctgactaaagatgaaatcctc
gagttataccttaacaagatttatctcggttaccgtgcctatggtgtcggtgcggcagca
caagtctatttcggtaagccgattgatcaactcacactgagtgaaatggcggtgattgcc
ggcttgccaaaagcaccgtcaacctttaacccgctttactcaatggatcgtgccacttcc
cgtcgtaatgtcgtgttatcgcgtatgttaagcgaaaactatattacgcaggcgcagtat
gatgaagcgcgtaatcagcctattgatgctaattatcacgcgccagaaatcgctttctct
gcgccgtatctttcagagttggtgcgccaggatatggtggcgcgttatggtgaaaaagcc
tacgaagatggttttaaggtttacaccaccatcgcgcgcaaaaatcagcaagccgcgcag
caagccgtacgcaataacgtaattgcttacgatatgcgccatggttaccgcggcccatcc
aatgtgctgtggaaagtgggcgaaacaccgtgggatcaaaccaggattgttgattcgtta
aagaatctaccggtctacggcccaatgttccctgccgttattacccaggcaaccccgaca
gaagcgacagcgatgatggctgacggcagcgccgtttccatcagtatggagggcatgcgc
tgggcgcgtccttatcgttcagataccgcacaaggcccaacgccacgcaaagtgacggat
gtcgtgcaagctgggcaacaaatctgggtgcgtaaggttgaagagagttggtggcttggg
caagtcccggacgtcaattccgcactggtttctatcaatccacatgacggtgcagttgtc
gcattagtgggtggttttgacttcaatcagagcaagtttaaccgcgccacgcaggcatta
cgccaggttggctccaacatcaaaccgttcctttatacagcagcaatggataaaggtctg
accctggcgagcgtgctgaacgatgtgccgatctcacgctgggatgccggtgccggttcc
gactggcgcccgaaaaactctccgccagaatatgcaggaccaatcaggttgcgtcagggg
cttggccaatcgaaaaacgtggtgatggtgcgtgcgatgcgagccatgggtgtcgattat
gcagctgaatacctgcaacgtttcggcttccctgcgcagaatattgtgcacaccgaatct
ctggccttaggttcagcctcgttcacgccgatgcaggtcgctcgcggttattctgtgatg
gccaacggtggcttcctggtcgacccgtactacatctcaaaaattgagactgaagttggc
ggcactctttttgaagccaaaccgaaagtggcttgtgctgattgtgatattccagtgatt
tacggtgaaacgcaaaagtctaatgtgctggaaaatcaggatgtggaagatgtcgcacaa
tctcaggaacagcagaacgccagcgtgccaatgccgaaactggaacaagcgaacagcgag
ttggttgcacagagcagcccgccggagtacgcaccgcatgtgattaacactccattggca
ttcctgatcaaaagtgcgctgaactccaatatttatggcgaaccaggttggcaaggtacc
ggctggcgtgcgggtcgtgatctaaagcgtaacgatattggcggcaaaaccggcaccacg
aacagctcgaaagacgcgtggttctcaggctacggacctggtgtggtgacatccgtatgg
attggttttgacgatcatcgccgtgaccttggacgaacctccgcatcaggcgctattaaa
gatcaaatctcaggttatgaaggtggggcgaagagtgctcaaccagcatgggatgatttt
atgaaagccgcactggaaggcgtaccggaagaaccgttaaccccaccaccgggcatcgtc
accgtgaatattgaccgttacaccgggcaattggcgaatggtggaagtagccgtccggaa
ttctttatcgaaggcactcaaccgacgcagcaggctgtgcatgaagtgggtaccacgata
attgataacggcgagagccacgagttgttctaa

DBGET integrated database retrieval system