KEGG   Buttiauxella sp. 3AFRM03: D8682_18100Help
Entry
D8682_18100       CDS       T05676                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
buf  Buttiauxella sp. 3AFRM03
Pathway
buf00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:buf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D8682_18100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:buf01002]
    D8682_18100
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:buf01011]
    D8682_18100
Enzymes [BR:buf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     D8682_18100
   3.4.21  Serine endopeptidases
    3.4.21.-  
     D8682_18100
Peptidases [BR:buf01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   D8682_18100
Peptidoglycan biosynthesis and degradation proteins [BR:buf01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   D8682_18100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AYN28727
UniProt: A0A3G2IJ21
LinkDB All DBs
Position
complement(3546718..3548151)
Genome map
AA seq 477 aa AA seqDB search
MRFFRFVIGLTSAVVFNVQAANIEDYTSQLPAGANLALMVQKIGAPAPSIDYHSQQMALP
ASTQKVITALAALLQLGPDFRFTTTLESHAQVSNGVLQGDLIARFGGDPTLKRQDIRNMV
AVLKKSGVQQIQGNVLVDTSVFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSISLYS
APKADDLAFIRIASYYPVVMFSQVRTLAKGSADAQYCELDVVPGDLNRFTLTGCMTQRAD
PLPLAFAIQDGASYAGAILKAELKEAGISYSGTLLRQTQANTPGTVIASKQSAPLHDLLK
VMLKKSDNMIADTVFRTIGHNRFGVPGTWRSGADAVRQILRQKAGVDLGNSIVVDGSGLS
RHNLISPATMMQVLQYIAQNDSELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGS
LQGVYNLAGFITTASGQRMAFVQYLSGYAVEPADQRNRRIPLVRFESRLYKDIYQNN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgattttttagatttgtcattggattgaccagtgctgtggtgtttaacgtccaggct
gccaacatagaagactatacctcccaattacctgcgggtgcgaatctggctttgatggtg
caaaaaataggtgcgccagctccttctattgactaccacagtcaacagatggctctgccc
gcaagtactcaaaaggtcattacggcgctagcagcactgcttcaattaggaccagacttc
aggtttaccaccacccttgagagtcatgctcaagtcagtaatggtgtcttacaaggtgac
cttattgcgcgatttggtggcgatcctacgttaaaacgtcaggatattcgcaatatggtg
gcagtcctgaaaaaatcgggtgtgcagcaaattcagggaaatgtgctggtagatacctcc
gttttcgccagccatgacaaagcacctggctggccatggaatgacatgacacagtgcttt
agcgccccgccagctgccgcaattgttgaccggaactgtttctctatttcgctatacagc
gcaccaaaagctgatgacttagcgtttattcgcatcgcttcttactacccagtagtgatg
ttcagccaggttcgtaccctcgccaaaggctccgcggatgcacaatattgcgaactggac
gtcgttccgggtgatttaaatcgctttacgctaaccggatgtatgacacaacgtgcagac
cctctcccgctggcattcgcgatacaagatggcgcaagttacgctggtgcgattttgaaa
gctgagctaaaagaagcgggcatcagttatagcggaaccttattacgccagacgcaagcg
aatacaccaggaacggtcatcgccagtaagcaatcggccccattgcacgatttgctaaag
gttatgctcaagaaatcggacaacatgattgccgataccgtttttcgtactatcggccat
aaccgttttggagtgccgggaacctggcgttccggagctgatgccgtacgtcaaatcctc
cggcagaaagcaggtgttgatttaggtaacagtatcgtcgttgatggttcggggctatcg
cgccacaatctcatctcccccgccactatgatgcaggtgttgcaatatatcgcccaaaat
gacagtgagcttaattttatctcaatgctaccgttagcgggttacgacggttcattacag
tatcgtgctggtcttcatcaggccggtgttgatggcaaagtttctgcgaaaaccggttca
ctgcaaggtgtttataaccttgctggatttattaccactgccagcggccaaagaatggcc
tttgtgcaatatttgtcaggctacgctgtagagcctgccgatcaacgtaaccgccgtatc
ccattagtgcgatttgaaagtcgtctctacaaggatatctaccagaataattga

DBGET integrated database retrieval system