KEGG   Burkholderia sp. CCGE1001: BC1001_0030Help
Entry
BC1001_0030       CDS       T01424                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00010  Glycolysis / Gluconeogenesis
bug00620  Pyruvate metabolism
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1001_0030
   00620 Pyruvate metabolism
    BC1001_0030
Enzymes [BR:bug01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BC1001_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: ADX53496
UniProt: E8YJC0
LinkDB All DBs
Position
1:complement(28637..30157)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQFLTTEFPYKKQYANFIGGEWVKPVGGEYFDNVSPITGEPFTSIPRSREADVEL
ALDAAHRAKAAWGKTSTTDRANILNRIADRMEANLQRLAVAETIDNGKPLRETMAADIPL
AIDHFRYFAGAVRAQEGSISEIDDDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLVELIQDLLPAGVLNVVNGFGLEAGKPLASSKRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVMSQDDSYFDKALEGFAMFALNQGEV
CTCPSRVLIDEKIYDRFMERALKRVAAITQGHPLDTKTMIGAQASQEQLEKILSYVDLGK
QEGAECLIGGERNVLGGELSKGYYVKPTVFRGNNKMRIFQEEIFGPVVSVTTFKTEDEAL
EIANDTLYGLGAGVWTRDGTRAYRFGRQIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcggagatgcagtttctgacgaccgaattcccgtacaaaaagcagtatgcg
aactttatcggtggcgaatgggtgaagccggtgggtggcgagtacttcgacaatgtgtcg
cccatcacgggcgagccattcacttccattccgcgctcccgtgaggccgacgtcgaactc
gcgctggatgccgcgcaccgcgcgaaagccgcatggggcaaaacctcgacgacggatcgc
gcgaacattctgaaccgcattgccgaccgcatggaagcgaacctgcagcggctcgcggtc
gctgaaacgatcgataacggcaagccgctgcgcgaaacgatggccgccgacattccgctt
gccatcgaccacttccgctatttcgccggcgccgtgcgcgcgcaggaaggctcgatctcc
gaaatcgacgacgacacggtggcctatcactttcacgagccactcggcgtggtcggtcag
atcattccgtggaatttcccgattctcatggcggtgtggaaactcgcccccgcgctcgcg
gccggcaattgcgtcgtgctcaaacccgccgagcaaacgcccgcatcgattctcgtcctc
gtcgaactgattcaggacctgctgcccgccggcgtgctgaatgtggtcaacggtttcggt
ctggaagcaggcaaaccgctcgcctccagcaagcgcatcgcaaagatcgcgttcaccggc
gaaaccaccacgggtcgcctgatcatgcagtacgcgagccagaacatcattccggtcacg
ctcgaactgggcggcaagagcccgaacatctttttcgccgacgtcatgagtcaggacgac
agctacttcgacaaagcgctcgaaggcttcgcgatgttcgcgttgaatcagggcgaagtg
tgcacgtgcccttcgcgcgtattgatcgatgaaaagatttacgaccgctttatggaacgc
gcgttgaaacgcgtcgcggcgatcacgcagggtcatccgctggatacgaagacgatgatc
ggcgcgcaggcttcgcaagagcagttggagaagatcctgtcgtatgtggatctcggcaaa
caggaaggcgccgaatgcctgatcggcggcgagcgcaacgtgcttggcggcgaactgagc
aagggctattacgtgaagcccactgtgttccgcggcaacaacaagatgcgcatcttccag
gaagagatcttcgggccggtggtgtcggtcacgacgttcaagaccgaagacgaagcgctc
gaaatcgccaacgacacgctgtacggtctcggcgcgggcgtctggacacgcgacggcacg
cgcgcctatcgcttcggccggcagattcaggcaggccgcgtgtggaccaattgctatcac
gcatatccggcgcacgcggcgtttggcggctacaagcaatcgggcattggccgcgaaaat
cacaagatgatgctcgaccattatcagcagaccaagaacctgctcgtgagctatagcgag
aaaccgctcgggttcttctaa

DBGET integrated database retrieval system