KEGG   Burkholderia sp. CCGE1001: BC1001_0441
Entry
BC1001_0441       CDS       T01424                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bug  Burkholderia sp. CCGE1001
Brite
KEGG Orthology (KO) [BR:bug00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BC1001_0441
Enzymes [BR:bug01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BC1001_0441
SSDB
Motif
Pfam: CN_hydrolase
Other DBs
NCBI-ProteinID: ADX53903
UniProt: E8YN56
LinkDB
Position
1:complement(484458..485366)
AA seq 302 aa
MSETHVSSSSSPATSHASSAAAPHAAGHELAGGAPGTFRVAALQMVSTPDRERNLAEAGR
LIAEAAADGAQLVLLPEYFCFMGFKDTDKLAVREAYRDGPIQRFLADAARRHKLWVIGGT
LPVTAPEPSRVLNTTLVFDPHGNEAARYDKIHLFNFEKGEESFDEARTICPGDEVRTFEA
PFGRVGLSVCYDLRFPELYRRMGDCTLMVVPSAFTYTTGRAHWEMLLRARAVENQCYVLA
AAQGGKHENGRRTWGHSMLVDPWGEIVAVRDEGAGVIAGTLERARIDEVRQSLPAWRHRV
LS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgagcgaaacacacgtctcttcatcttcgtcccctgctacgtcccacgcctcgtccgcc
gctgcgccgcatgctgccggacacgagctggcgggcggcgcgccgggcactttccgcgtc
gccgcgctgcaaatggtgagcacgccggatcgcgagcgcaatctcgccgaagccgggcgt
ctgatcgcagaagccgccgcagacggtgctcagctggttctcctgcccgagtacttctgc
ttcatgggctttaaggacaccgacaagctcgccgtgcgcgaggcctaccgcgacggcccg
atccagcgttttctcgccgatgccgcgcgccgccacaagctatgggtgattggcggcacg
ctgccggtcacggcgccggaaccgtcgcgcgtattgaacactacgctcgtgttcgatccg
cacggcaacgaggccgcgcgctacgacaagatccatctgttcaacttcgaaaaaggcgag
gaatcgttcgacgaggcgcgcaccatttgccccggcgacgaggtccgcaccttcgaggcg
ccgttcggccgcgtcggcctgtcggtctgctacgatctgcgctttcctgagctgtaccgg
cgcatgggcgattgcacgctgatggtggtgccgtcggcgtttacttacacgacgggccgc
gcccactgggaaatgctgctgcgcgcccgcgctgtcgaaaaccagtgctacgtgctggcc
gccgcgcagggcggcaaacacgagaacggccgccgcacctggggccacagcatgctcgtc
gacccgtggggcgagatcgtggcggtgcgcgacgaaggcgccggcgtgatcgcggggacg
ctcgaacgcgcgcgcatcgacgaggtgaggcagagcttgcccgcctggcgtcatcgggtg
ctgagctag

DBGET integrated database retrieval system