KEGG   Burkholderia sp. CCGE1001: BC1001_0820Help
Entry
BC1001_0820       CDS       T01424                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00620  Pyruvate metabolism
bug00680  Methane metabolism
bug00710  Carbon fixation in photosynthetic organisms
bug01100  Metabolic pathways
bug01120  Microbial metabolism in diverse environments
bug01200  Carbon metabolism
Module
bug_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1001_0820
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1001_0820
   00680 Methane metabolism
    BC1001_0820
Enzymes [BR:bug01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BC1001_0820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 RAG1_imp_bd
Motif
Other DBs
NCBI-ProteinID: ADX54274
UniProt: E8YG73
LinkDB All DBs
Position
1:complement(912276..915443)
Genome map
AA seq 1055 aa AA seqDB search
MTSSGSARSARRNTASPNASIDDAAASPAAASSTVETTQPPKAKRATSGEKAANAAKAVK
AEKTSAPVKADKTVKTSKADKSGEAAPSAKKGKAKAAGKAPVLQAVSEDTVMAAPKTNGR
TRDDKDHPLFQDIRYLGRLLGDVLREQEGDAVFDVVETIRQTAVRFRREDDNAAAQTLDK
KLRSLSPEQTVSVVRAFSYFSHLANIAEDRHRNRRHRIHALAGSAAQPGSIAYALERLVE
AGAAATPVLQQFFNDALIVPVLTAHPTEVQRKSILDAEHDVARLLAERDQQLTDRERAQN
ERMLRARVTSLWQTRMLRDSRLTVADEIENALSYYRATFLEEIPALYADIEEALKEHGLE
ARLPPFFQMGSWIGGDRDGNPNVTAETLEHAIARQAEVIFEHYLEQVHKLGAELSVSNLL
AGASDELKALAEISPDRSPHRTDEPYRRALIGMYTRLAASARVRLGEGAVPLRSAGRGAA
PIRATPYDDASEFVRDLHVLMDSLAAHHGAPLAAPRLAPLARAAEVFGFHLASIDLRQSS
DIHEAVIAELLKRAGVHDDYAALDESAKLEVLLAELAQPRPLRLPYAEYSDLVKSELGVL
EQARVTREKFGARAVRNYIISHTETVSDLVEVMLLQKETGLLQGRLGNADNPAKAALMVI
PLFETIPDLRNAPHIMRDLLALPGADSIIEHQGNEQEVMLGYSDSNKDGGFLTSNWELYR
AELALVSLFNERGITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVDGQIRLTEQGEVIAS
KFGNPEIGRRNLETVVAATLEASLLPHGNAPADLPAFEETMQQLSDAAMASYRALVYETP
GFKEYFFESTPISEIAELNIGSRPASRKLQDPKHRKIEDLRAIPWGFSWGQCRLLLTGWY
GFGSAVAAYLDSAPSDAERGRRLSLLKKMHKSWPFFSTLLSNMDMVLAKTDLAVASRYAA
LVSDKKLRKHVFERIVAEWERTSKVLSEITGKRERLAENPLLARSIKNRFPYLDPLNHLQ
VELLKRHRAGDTNARVRRGIHLTINGIAAGLRNTG
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcttccggatcggcgcgctccgcccgccgcaacactgcatcgcccaacgcttcc
attgacgacgccgccgcgtccccggccgccgcatcgtccactgtcgagaccacgcagccg
cccaaagccaaacgcgcgacgtccggcgagaaggccgccaacgcggcaaaagccgtcaaa
gccgagaaaacttccgcgcccgtcaaagcggacaaaaccgtgaagacgtcgaaggcggac
aaatccggcgaggccgcgccttccgcgaaaaagggcaaagccaaagccgccggcaaagcg
ccggtgctgcaagccgtatccgaagacaccgtcatggccgcgccaaaaaccaacggccgc
acgcgcgacgacaaggatcatccgctcttccaggacatccgctacctgggacggctgctc
ggcgacgtgctgcgcgagcaggaaggcgacgcggtgttcgacgtcgtcgaaacgatccgg
cagacagccgtgcgttttcgccgtgaggacgacaacgccgccgcgcagacgctcgacaag
aagctgcgctcgctgagccccgagcaaacggtgagcgtggtgcgcgcgttcagctatttt
tcgcatctcgcgaatattgccgaagaccgtcaccgcaaccgccgtcaccgcattcatgcg
ctcgccggctcggccgcgcagccgggcagcatcgcgtatgcattggagcggcttgtcgaa
gccggcgccgcggccacgcccgttttgcagcagtttttcaacgacgcgctgatcgtgccc
gtgctcaccgcgcacccgacggaagtgcagcgcaagagcattctcgacgccgagcacgac
gtggcgcgcctgctcgccgaacgcgaccagcagttgaccgaccgcgagcgcgcgcagaac
gagaggatgctgcgcgcgcgcgtcacgtcgctgtggcaaacgcggatgctgcgcgactcg
cggctcaccgtcgccgatgaaatcgagaacgcgctgtcctattaccgcgcgacgttcctc
gaggaaattcccgcgctctacgccgatatcgaagaagcgctcaaggagcacggcctcgaa
gcgcgtctgccgcccttcttccagatgggcagttggatcggcggcgaccgcgacggcaat
ccgaacgtcaccgccgaaacgctcgagcacgctatcgcgcgccaggccgaggtgatcttc
gaacattatctggagcaggtgcacaagctcggcgcggaactgtccgtgtcgaatctgctg
gccggcgcgagcgacgagctgaaggcgctcgccgaaatttcgccggaccgctcgccgcat
cgcacggacgagccgtatcggcgcgcgctgatcggcatgtacacgcggctcgcggcaagc
gcgcgcgtgcgtctcggcgaaggcgccgtgccgctgcgcagcgccggccgcggcgccgcg
ccgatccgcgccacgccttacgacgacgcctccgagttcgtgcgcgacctgcatgtgctg
atggattcgctcgccgcgcatcacggtgcgccgctcgccgcaccgcgtctcgcgccgctc
gcccgcgcggccgaggtgttcggcttccatctcgccagcatcgacttgcgccagagttcg
gacattcacgaagcggtgatcgcggagctgctcaagcgcgcgggcgtccacgacgactac
gcggcgctcgacgaaagcgcgaagctcgaggtgctgctcgccgaactcgcgcagccgcgt
ccgctgcgcctgccgtatgccgagtactcggatctcgtgaaaagcgaactcggcgtgctg
gagcaagcgcgtgtgacgcgcgaaaagttcggcgcgcgcgcggtgcgcaactacatcatt
tcgcacacggagacggtcagcgatctcgtcgaagtgatgctgctgcaaaaagaaaccggc
ttgctgcaaggccgactcggcaacgcggacaacccggccaaagccgcgctgatggtgatt
ccgcttttcgaaaccattcccgacttgcgcaacgcgccgcacatcatgcgcgatctgctc
gcgctgccgggcgccgattcgatcatcgagcaccagggcaacgagcaggaagtgatgctc
ggctattcggacagcaacaaggacggcggctttctcacgtcgaactgggagctgtaccgc
gcggaactcgcgctggtgtcgctcttcaacgagcgcggcatcacgctgcggctctttcat
gggcgcggcggcaccgtcggccgtggcggcggcccgacctatcaggcgattctgtcgcag
ccgccgggcaccgtcgacggtcagatccgcttgaccgagcaaggcgaagtgatcgcgagc
aagttcggcaatccggaaatcggccggcgcaatctggagacggtggtcgcggccacgctc
gaagcgtcgctactgccgcacggcaatgcgcccgccgatctgcccgccttcgaggaaacc
atgcagcagttgtccgacgcggccatggcctcgtatcgcgcgctggtgtatgagacgccc
ggcttcaaggagtatttcttcgagtcgacgccgatctccgagatcgccgagctgaacatc
ggcagccggccggcctcgcgtaagttgcaggacccgaagcatcgcaagattgaagatctg
cgcgcgattccgtggggcttttcatggggccaatgccggctgctgctgaccggctggtat
ggtttcggcagcgcggtcgccgcctatctcgacagcgcgccgagtgacgccgagcgcggg
cgccgtctttcgctgctgaagaaaatgcacaagagctggccgttcttctcgacgctgctc
tcgaacatggacatggtgctcgcgaagaccgacctcgcggtggcctcgcgctacgcggcg
ctcgtgtccgacaagaagctgcgcaagcacgtgttcgagcggatcgtcgcggaatgggag
cgcacgtcgaaggtgttgtcggagatcaccggcaaacgcgagcggctcgcggagaatccg
ctgctcgcgcggtcgatcaagaaccgctttccgtatctcgatccgctcaatcacctgcag
gtcgaactgctcaagcgtcaccgtgcgggcgacaccaacgcgcgcgtgcggcgcgggatt
catttgaccatcaacgggatcgcggcggggttgcggaatacgggttag

DBGET integrated database retrieval system